KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346342
Entry
4346342           CDS       T01015                                 

Definition
(RefSeq) inorganic phosphate transporter 1-6
  KO
K08176  MFS transporter, PHS family, inorganic phosphate transporter
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4346342
Transporters [BR:osa02000]
 Major facilitator superfamily (MFS)
  Phosphate and organophosphate transporters
   Phosphate:H+ symporter (PHS) family [TC:2.A.1.9]
    4346342
SSDB
Motif
Pfam: Sugar_tr MFS_1 MFS_4 OATP
Other DBs
NCBI-GeneID: 4346342
NCBI-ProteinID: XP_015649112
UniProt: Q8H6H0
Position
8
AA seq 534 aa
MGGGGGEQQQLEVLHALDVAKTQWYHFTAIVVAGMGFFTDAYDLFCISLVTKLLGRIYYR
VDGSPSPGTLPPHVSASVNGVAFVGTLSGQLFFGWLGDKLGRKRVYGITLMLMVLCSLAS
ALSFGHTPTSVMATLCFFRFWLGFGIGGDYPLSATIMSEYANKKTRGAFIAAVFAMQGFG
IITGGLVAILVSASFRAAFPAPPYGEDPVASTPPQADFVWRIILMLGALPAALTYYWRTK
MPETARYTALVANNAKQAAADMSKVLQVVEMRNIGNNGGSRRPFGLFSGEFVRRHGLHLV
GTSATWLLLDIAFYSQNLFQKDIFSAVGWIPKAATMSALEELFRIARAQTLIALCGTVPG
YWFTVALIDVVGRFKIQAVGFFMMTLFMLTLALPYHHWTAPGKNHVGFLLLYGLTFFFAN
FGPNSTTFIVPAEIFPARLRATCHGISAASGKLGAIVGSFGFLYLAQSPDRSKTEHGYPP
GIGVRNSLFLLAACNLLGLLFTFLVPESKGKSLEEMSGDAEAQEEAPPPLQTVL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgggcggcggcggcggggagcagcagcagcttgaggtgctccacgccctggacgtggcc
aagacgcaatggtaccatttcacggccatcgtggtggccggaatggggttcttcaccgac
gcctatgacctcttctgcatctccctcgtcaccaagctgctgggccgcatctactaccgc
gtcgacgggtccccgtcccccggcacgctccccccgcacgtctccgcctccgtcaacggc
gtggccttcgtgggcacgctctcagggcaactcttctttggctggctgggcgacaagctc
ggccgtaagcgcgtctatggcatcaccctcatgctcatggtgctctgctccctcgcctcc
gcgctctcctttggccacaccccgacctccgtcatggccaccctctgcttcttccgcttc
tggctcggcttcggcatcggcggcgactacccgctctccgccaccatcatgtccgagtac
gccaacaagaagacgcgtggcgccttcatcgccgccgtcttcgcgatgcagggcttcggc
atcatcaccggcggcctcgtcgccatcctcgtctccgcctccttcagggccgccttcccg
gcgcctccctacggcgaggaccccgtggcctccacgccgccgcaggccgacttcgtgtgg
aggatcatactcatgctgggcgcgctgccggcggcgctcacctactactggcgcaccaag
atgcccgagacggcgcgctacacggcgctcgtggccaacaacgccaagcaggccgcggcc
gacatgtccaaggtgctgcaggtggtggagatgcgtaatattggtaataatggtggcagc
aggaggccgttcgggctgttctccggcgagtttgtccggcggcacgggctgcacctggtg
ggcacgtcggcgacgtggttgctgctggacattgcgttctacagccagaacctgttccag
aaggacatattcagcgcggtggggtggatccccaaggcggcgacgatgagcgcgctggag
gagctgttccgcatcgcgcgggcgcagacgctgatcgcgctgtgcgggacggtgcccggc
tactggttcaccgtcgcgctcatcgacgtggtgggccgtttcaagatccaggccgttggc
ttcttcatgatgaccctcttcatgctcaccctcgccctgccgtaccaccactggacggcg
ccggggaagaaccacgtcggcttcctgctgctctacggcctcaccttcttcttcgccaac
ttcggccccaactccaccaccttcatcgtgccggcggagattttcccggcgcggctgcgg
gccacgtgccacggcatctcggcggcgtcggggaagctgggcgccatcgtcggatccttc
gggttcctgtacctggcgcagagccccgaccggagcaagacggagcacgggtaccctccg
ggcatcggcgtccgcaactcgctcttcctgctcgccgcctgcaacctgctgggcctgctc
ttcaccttcctcgtgccggagtccaaggggaagtcgctggaggagatgtccggcgacgcc
gaggcccaggaggaggcgccgccgcccctgcaaactgtactgtag

DBGET integrated database retrieval system