KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347180
Entry
4347180           CDS       T01015                                 

Definition
(RefSeq) oryzain gamma chain
  KO
K01366  cathepsin H [EC:3.4.22.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4347180
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.16  cathepsin H
     4347180
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C1: papain family
   4347180
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 4347180
NCBI-ProteinID: XP_015611626
UniProt: P25778 Q0J1G2 B7ECL3
Position
9
AA seq 362 aa
MAHRRIILLLAAAAVAATSAVAAASSGFDDSNPIRSVTDHAASALESTVIAALGRTRDAL
RFARFAVRHGKRYGDAAEVQRRFRIFSESLELVRSTNRRGLPYRLGINRFADMSWEEFQA
SRLGAAQNCSATLAGNHRMRDAAALPETKDWREDGIVSPVKDQGHCGSCWTFSTTGSLEA
AYTQATGKPVSLSEQQLVDCATAYNNFGCSGGLPSQAFEYIKYNGGLDTEEAYPYTGVNG
ICHYKPENVGVKVLDSVNITLGAEDELKNAVGLVRPVSVAFQVINGFRMYKSGVYTSDHC
GTSPMDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCGIATCASYPI
VA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcccaccgccgcatcatcctcctcctcgccgccgccgccgtcgccgcgacctccgcc
gtcgccgccgcgtcctccggcttcgacgactccaacccgatccgctccgtcacggaccac
gccgcctccgcgctcgagtcaaccgtcatcgccgccctcggccgcacccgcgacgccctc
cgcttcgcccgcttcgccgtcaggcatgggaagaggtacggcgacgcggcggaggtgcag
cggcggttccggatcttctccgagagcctcgagctcgtccgctccaccaaccggaggggc
ctcccctaccgcctcggcatcaaccgtttcgcggacatgagctgggaggagttccaggcg
agccggctcggcgcggcgcagaactgctcggcgacgctcgccggcaaccaccggatgcgc
gacgccgccgctctcccggagaccaaagactggagggaggatgggatcgtgagccccgtg
aaagaccagggtcactgtggttcctgttggaccttcagcaccactggttctcttgaggca
gcatatactcaggccactgggaagcctgtctctctttctgagcagcagctggttgattgt
gctactgcatacaataatttcggatgcagtggaggcctaccatctcaggcctttgagtac
atcaaatacaatggtggccttgacactgaagaggcttacccttacacgggtgtcaatggc
atctgtcattacaagcctgaaaacgttggagtcaaggttttggactccgttaacatcacc
ctgggtgctgaggatgagctgaagaatgctgttggacttgttcgtccagttagtgttgcc
tttcaggtgatcaacggtttcaggatgtacaagagtggagtttacacaagtgaccattgt
ggaacttctccaatggatgtgaaccacgctgttctggccgttggctatggtgtcgaaaat
ggcgttccctactggctcatcaagaactcatggggtgcagactggggtgacaatggttac
ttcaagatggaaatgggcaagaacatgtgcggtattgctacttgcgcatcctaccctatt
gttgcatga

DBGET integrated database retrieval system