KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347265Help
Entry
4347265           CDS       T01015                                 

Definition
(RefSeq) alpha-amylase isozyme 3C
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4347265
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     4347265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 4347265
NCBI-ProteinID: XP_015612114
UniProt: P27939 A0A1B0SZS4
Position
9
AA seq 437 aa AA seqDB search
MAKHSTTMSCLLFFVLLCLGSHLAQAQVLFQGFNWESWKKQGGWYNFLHSHVDDIAATGV
THVWLPPPSHSVAPQGYMPGRLYDLDASKYGTGAELRSLIAAFHSKSIKCVADIVINHRC
ADYKDSRGIYCIFEGGTPDSRLDWGPDMICSDDTQYSNGRGHRDTGADFGAAPDIDHLNT
RVQTELSDWLNWLKSDVGFDGWRLDFAKGYSATVAKTYVDNTDPSFVVAEIWSNMRYDGN
GEPSWNQDGDRQELVNWAQAVGGPASAFDFTTKGELQAAVQGELWRMKDGNGKAPGMIGW
LPEKAVTFIDNHDTGSTQNSWPFPSDKVMQGYAYILTHPGVPCIFYDHVFDWNLKQEIST
LAAVRSRNGIHPGSKLNILAADGDVYVAMIDDKVITKIGTRYDVGNLIPSDFHVVAHGNN
YCVWEKSGLRVPAGRRH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcattccaccacaatgagctgcctcctattcttcgtcttgctctgtttgggc
tctcacttagcccaggctcaggttctctttcagggattcaactgggagtcatggaagaag
cagggtgggtggtacaacttcctccatagccacgtcgacgacatcgccgcgaccggagtc
acacacgtctggctcccgccgccgtcgcactccgtcgcgccacagggatacatgccggga
cggctctacgacctggacgcgtccaagtacgggacgggggcagagctcaggtcgctgatc
gccgccttccacagcaagagcatcaagtgcgtcgccgacatcgtcatcaaccaccggtgc
gcggattacaaggatagccgtggcatctactgcatcttcgagggtggcacgccggacagc
cgcctcgactggggtcccgacatgatctgcagcgacgacacgcagtactccaacggccgc
ggtcaccgcgatactggcgcagacttcggcgcggcgcccgacatcgaccacctcaacacg
cgtgtgcagacagagctctccgactggctcaactggctcaagtccgacgtcggcttcgac
ggctggcgcctcgacttcgccaagggatactcggcgaccgtcgccaagacgtacgtggac
aacaccgacccgtccttcgtcgtcgccgagatatggagcaacatgcgttacgacggcaac
ggtgagccgtcgtggaaccaggacggtgaccggcaggagttggtgaactgggcgcaggcc
gtcggtggccctgcatcggcgttcgacttcacgaccaagggcgagctgcaggcagcggtg
caaggtgagctgtggcggatgaaggatggcaacggcaaggcgccggggatgattggctgg
ctgccggagaaggctgtcaccttcatcgacaatcatgacactggctccacacagaactca
tggccgttcccctccgacaaggtcatgcagggctacgcctacatcctcacacaccctgga
gtaccctgcattttctacgaccatgtgtttgactggaacttgaagcaggagatcagcaca
ttggccgcggtgaggtcaagaaatggaattcatcctgggagcaagctgaacatccttgct
gctgacggagatgtctacgtcgccatgatcgatgacaaggtgatcacaaagattgggact
cggtatgatgtgggcaacttgatcccgtcagacttccatgtcgttgctcacggcaacaat
tactgcgtctgggaaaagagtggtcttagagttccagcagggcggcgccactag

DBGET integrated database retrieval system