KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347422Help
Entry
4347422           CDS       T01015                                 

Definition
(RefSeq) 60S ribosomal protein L9
  KO
K02940  large subunit ribosomal protein L9e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Module
osa_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    4347422
Ribosome [BR:osa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    4347422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L6
Motif
Other DBs
NCBI-GeneID: 4347422
NCBI-ProteinID: XP_015612091
UniProt: P49210
Position
9
AA seq 190 aa AA seqDB search
MKTILASETMEIPEGVTVQVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEGGRKLQVDAWF
GTRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRNFLGEK
KVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYV
SDKGTITEDA
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatcctggcgtccgagacgatggagatcccggagggggtgacggtgcaggtc
gccgcgaaggtggtgacggtggagggcccccgcgggaagctgacccgcaacttcaagcac
ctcaacctcgacttccagctgctggagggcggccgcaagctgcaggtggacgcgtggttc
ggcacccgccgcaccatggccgccatccgcaccgccatctcccacgtccagaacctcatc
accggcgtcaccaagggctaccgctacaagatgcgcttcgtctacgctcacttccccatc
aacgcctccatcaccaactccaacaccgccatcgagatcaggaacttcttgggcgagaag
aaggtgaggaaggttgacatgctcgagggggtgaccatcttgcggtcggagaaggtgaag
gacgagctcgtcctcgacggcaacgacatcgagctcgtctctcgctcagcagccctcatc
aaccagaaatgccacgtgaagaacaaggatatcaggaagttcttggatggtatctacgtg
agcgacaagggtaccatcacagaggatgcgtaa

DBGET integrated database retrieval system