KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348317
Entry
4348317           CDS       T01015                                 

Definition
(RefSeq) profilin-A
  KO
K05759  profilin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4348317
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4348317
   04147 Exosome [BR:osa04147]
    4348317
Membrane trafficking [BR:osa04131]
 Others
  Actin-binding proteins
   Others
    4348317
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     4348317
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4348317
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 4348317
NCBI-ProteinID: XP_015613794
UniProt: Q9FUD1 A0A1L2JID9 I3QD64
Position
10
AA seq 131 aa
MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVVGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
NT seq 396 nt   +upstreamnt  +downstreamnt
atgtcgtggcagacgtacgtcgacgagcacctgatgtgcgagatcgagggccaccacctc
acctccgccgccatcgtcggccacgacggcaccgtctgggcacagagcgccgccttccct
cagttcaaaccggaggagatgaccaacatcatgaaggacttcgacgagccggggttcctc
gccccgaccggactgtttcttggaccaaccaagtacatggtcatccaaggtgaacctggc
gctgtcattcgtggcaagaagggatcaggaggcatcacagtgaagaagaccgggcaggcg
ctggtggtcggcatctacgacgagcccatgaccccggggcagtgcaacatggtggttgag
aggctcggtgactacctcgtagagcagggcctgtag

DBGET integrated database retrieval system