KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348589Help
Entry
4348589           CDS       T01015                                 

Definition
(RefSeq) pectinesterase 31
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4348589
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     4348589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 4348589
NCBI-ProteinID: XP_015614296
UniProt: Q7XEU2
Position
10
AA seq 336 aa AA seqDB search
MAQQQPRRVLRVAPPGRGGARAEAERGEEGEAVFATVQAAVDAVPVGNRVRTVIRLAPGT
YREPVYVAKAKNLVTLSGEAGSPEATVITWDNTATRIKHSQSSRVIGTGTFGCGTIIVEG
EDFIAENITFENSAPQGSGQAVALRVTADRCAFYNCRFLGWQDTLYLHYGKQYLRDCYIE
GNCDFIFGNSIALLEHCHIHCKSAGYITAHSRKSSSETTGYVFLRCIITGNGEAGYMFLG
RPWGPFGRVVFAHTFMDRCIKPAGWHNWDRSENERTACFFEYRCSGPGFRPSNRVAWCRQ
LLDVEVENFLSHSFIDPDLDRPWLIQMMAIKVPVSA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcagcagccgcggcgagttctccgcgtggcgccgccggggcgaggaggggcg
cgcgcggaggcggagcggggggaggagggggaggcggtgttcgcgacggtgcaggcggcg
gtggacgcggtgccggtggggaacagggtgcggacggtgatccgcctcgcgccggggacg
tacagggagcccgtctacgtcgccaaggccaagaacctcgtcaccctctccggcgaggcc
ggctcgcccgaggccaccgtcatcacctgggacaacaccgccacccgcatcaagcactcc
cagtcgtccagggttattgggacaggaacgtttggatgcggaacaattattgtggagggg
gaggatttcatcgcagagaatatcacatttgagaactcagctcctcaggggtctgggcag
gcagttgctctccgagtaacagcagataggtgtgccttctacaattgcaggttccttggt
tggcaagacacattatatttacattatggaaaacaatacttaagggactgttacatcgaa
ggtaactgtgacttcatcttcggcaactctattgccctgttggaacattgccatattcat
tgcaaatcagcgggttacattactgctcacagccggaaatcctcatcagaaactactggt
tatgtgttcttgaggtgtattattactggaaatggagaagctggatatatgttcctgggt
cggccttggggaccgtttggaagggttgtctttgcgcacacttttatggatcgttgtatt
aagcctgctgggtggcataattgggacagatctgagaatgaacgaactgcttgcttcttt
gagtacaggtgctcagggccaggtttccgcccatcaaaccgagtggcttggtgtagacaa
ttgcttgatgttgaagtggagaatttcctttctcactctttcattgatccagaccttgat
aggccttggctcatccagatgatggcaataaaagtaccagtctcagcatag

DBGET integrated database retrieval system