KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348646Help
Entry
4348646           CDS       T01015                                 

Definition
(RefSeq) heat stress transcription factor A-2c
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4348646
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     4348646
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     4348646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD HSF_DNA-bind Cupin_2 AraC_binding Cupin_1 APG6
Motif
Other DBs
NCBI-GeneID: 4348646
NCBI-ProteinID: XP_015613648
Position
10
AA seq 641 aa AA seqDB search
MENEFQDGKTEVIEAWYMDDSEEDQRLPHHREPKEFIHVDKLTELGVISWRLNPDNWENC
ENLKRIREARGYSYVDICDVCPEKLPNYETKIKSFFEEHLHTDEEIRYCLEGSGYFDVRD
QNDQWIRIALKKGGMIVLPAGMYHRFTLDTDNYIKAMRLFVGDPVWTPYNRPHDHLPARK
EFLAKLLKSEGENQAVEGFCSVTQKLPNWADLDDELSPSNWATCPPPGPSTCPHLSHPTP
LPPSLHSPEASPRPVATLPYAASRTFHTSPDASRRTARAGGGVMDPAAAGIVKEEMLESQ
QQQRQEDGGAAPRPMEGLHEVGPPPFLTKTYDLVEDPATDGVVSWSRAGNSFVVWDPHVF
ADLLLPRLFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQRHLLKTIKRRKPPSN
APPSQQQSLTSCLEVGEFGFEEEIDRLKRDKNILITEVVKLRQEQQATKDHVKAMEDRLR
AAEQKQVQMMGFLARAMRNPEFFQQLAQQKEKRKELEDAISKKRRRPIDNVPFYDPGETS
QTEQLDSPYLFDSGVLNELSEPGIPELENLAVNIQDLGKGKVDEERQNQTNGQAELGDDF
WAELLVEDFTGKEEQSELDGKIDGIDELAQQLGYLSSTSPK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgaattccaggatggtaagacggaggtgatagaagcatggtacatggatgat
agcgaagaggaccagaggcttcctcatcaccgcgaacccaaagaattcattcatgttgat
aagcttacagaactaggagtaatcagctggcgcctaaatcctgataactgggagaattgc
gagaacctgaagagaatccgcgaagccagaggttactcttatgtggacatttgtgatgtg
tgcccagagaagctgccaaattatgaaactaagatcaagagtttctttgaagaacacctg
cataccgatgaagaaatacgctattgtcttgaagggagtggatactttgatgtgagagac
caaaatgatcagtggattcgtatagcactgaagaaaggaggcatgattgttctgcctgca
gggatgtaccaccgctttacgttggacaccgacaactatatcaaggcaatgcgactgttt
gttggcgatcctgtttggacaccctacaaccgtccccatgaccatcttcctgcaagaaag
gagtttttggctaaacttctcaagtcagaaggtgaaaatcaagcagttgaaggcttctgc
agcgtgacccaaaagctgccaaactgggccgacctcgatgatgagttgtcaccctcaaat
tgggccacctgtccaccacccggcccatccacctgcccccatctgtcccacccaaccccc
ctccccccctctctccactctccagaagcttctccgcggccagtggcgacgctaccctac
gcggcgtctagaaccttccacacctctcccgacgcctctcgacgtacggcgagggcggga
gggggggtcatggacccggcggcggcgggcattgtgaaggaggagatgctggagtcgcag
cagcagcagcggcaggaggatggcggggcggcgccgcggccgatggaggggctgcacgag
gttgggccgccgccgttcctgacgaagacgtacgacctggtggaggacccggccaccgac
ggcgtcgtgtcgtggagccgcgcgggcaacagcttcgtcgtctgggacccgcacgtcttc
gccgacctcctcctcccgcgcctcttcaagcacaacaacttctccagcttcgtccggcag
ctcaacacctacggcttcagaaaggtcgatcctgataggtgggagtttgcaaatgagggt
tttctcaggggccaaaggcatctcctgaaaacgataaagagaaggaagcccccgtccaat
gcacctccgtcacaacaacagtccctcacatcttgtctggaagttggtgagtttggattc
gaggaagaaattgacaggctgaagcgtgataagaacatcttgatcacagaggtagtaaag
ctaaggcaggagcagcaggccactaaagatcatgtgaaagccatggaagataggctacga
gccgctgagcagaaacaggtccagatgatggggttcttggcaagagcaatgcgcaaccca
gagttcttccagcagttggcacagcagaaagagaagaggaaggagcttgaggatgccatc
tcgaagaaaagaaggcggcctatagacaatgttccattctatgaccctggggaaacaagt
cagactgagcaacttgattcgccgtatttgtttgattcaggtgtgcttaatgagttaagt
gaacctggaatccctgagctggagaatctcgcagtgaacattcaggatctggggaagggt
aaagtagatgaagagaggcagaatcaaactaatggtcaggcagagctcggagatgacttc
tgggcagagctgttggttgaagatttcacaggcaaggaggagcagtcagagttggatggc
aaaattgacggcatcgacgaactggctcaacagttggggtatctgagctctactagtcca
aaatag

DBGET integrated database retrieval system