KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349220Help
Entry
4349220           CDS       T01015                                 

Definition
(RefSeq) C-terminal binding protein AN
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 4349220
NCBI-ProteinID: XP_015614671
UniProt: Q8LN38
Position
10
AA seq 650 aa AA seqDB search
MLHGPAHSPPPAAAAVAVAGGGGGEPLVVTLNCLEDPSMEQEVLAGAAAVEHAPLSALSS
GRVEAAAAVLLTSLAFLPRAAQRRLRPWQLILCLGSPDRAADAAVAAELGLRLVHVDANR
AEEVADTVMALFLGLLRRTHLLSRHASSYSAPPAGWLGSVQPLCRGMRRCRGLVLGIVGV
NAAARCLATRSLAFSMSVLYFDPLHEANGKTKRPSILFPSAARRMDTLNDLLTASDLVSL
HCALTNDTTHILNAERLQHIKPGAFIVNTGSCQLIDDCALKQLLIDGTIAGCALDGAEGP
QWMEAWVREMPNVLILPRSADYSEEVWIEIREKALAILQSFFYDGVVPNNALSDDEEEIT
EAGCEDDQLAKQAKEQVCDGGQQTDESQLTLECDKRRAISHSEEPQASGQSQNRENVVPR
SEGRRSRSGKKGKKRPARRKSQQKRDELLSTLEGGSNYSSRMDDDTVTSGKDQVLSSSSR
FASPEDCKTKLRSSAEFPMEIISENKLTAGLSIKPLERLKDGFVVALRTRDNSGFHVARE
RVAGVGWYLDVVSKATKRDPAAQFLITFRNKDTMGLRSFVAGGKLLQVNKTMELVFASYS
FDVWESWTLEGSLLDCCKLVNRKIPSVVLEVYIEILAAVSEEDGVTRWLD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacggcccggcccattcgcctccgccggccgccgccgccgtcgccgtcgccggc
ggcggcggcggggagccgctggtggtgacgctcaactgcctggaggacccgtcgatggag
caggaggtgctcgcgggggcggcggcggtggagcacgccccgctctccgcgctttcatcc
gggcgcgtcgaggccgccgccgccgtgctcctcacctcgctcgcgttcctcccgcgcgcc
gcgcagcggcggctccgcccctggcagctgatcctctgcctcggttcccccgaccgcgcc
gcggacgccgccgtggccgcggagctcgggctccgcctggtccacgtcgacgccaaccgc
gccgaggaggtagccgacaccgtcatggcgctcttcctcggcctcctccgccgcacccac
ctgctgtcccgccacgcctcctcctactccgcgccgcccgccgggtggctcggctccgtc
cagccgctctgccgcggaatgcggcgctgccgtgggctagtgcttggtatcgtcggggtc
aacgccgccgcgcgatgcctcgccacccgcagcctcgcgttcagtatgagcgtgctctac
ttcgatccgctccatgaggctaatgggaaaacaaagcggccttctattttatttccttct
gctgccagaagaatggatactctcaatgatttattgacagcaagtgatcttgtttcactt
cactgtgcgttaacaaatgatacaacacatatactcaatgccgagcgtctgcagcacata
aaacctggagctttcatagtcaataccggtagctgtcaactgatagatgactgtgcactc
aaacaactcttaattgatggcactatagctgggtgcgcattggatggtgctgaaggtcca
caatggatggaagcatgggtgcgtgagatgccgaatgtattaattcttcctcgaagtgca
gattacagtgaagaagtgtggattgaaatcagagaaaaggcactcgcaatattgcaatcc
tttttctatgatggtgttgttccaaacaatgctctttctgatgatgaagaagaaataact
gaagctggatgtgaggatgatcagctagcaaaacaggcaaaagaacaggtttgcgatggt
ggacagcagacagatgaaagtcagttaactttagaatgtgacaagagaagagccatttcc
cactctgaggagccccaagcttcagggcagtctcaaaacagagaaaatgttgtgcccaga
tcagaaggaaggcgcagccgatctggaaagaaagggaaaaagagacctgctcgccgcaaa
tcacaacagaaaagggacgaattgttgtcaactttagaaggtggaagtaattactcctca
cgtatggatgatgatactgtaacgagtggcaaggatcaagtgttaagttccagttcacga
tttgcttcccctgaggattgtaaaaccaagctgagatcttctgccgaatttccaatggaa
ataatttctgaaaataaactgactgcagggcttagtataaaacctcttgagagattgaaa
gatggcttcgttgttgccctaaggaccagggataattcagggtttcatgttgcaagagaa
agagttgcaggagttgggtggtatcttgatgttgtgtcaaaagctacaaagagggatcct
gctgctcagtttctaattacttttagaaacaaggatactatgggcttgcgatcttttgtt
gctggtggcaagttattgcaggttaataagactatggagcttgtatttgcgagctattct
tttgatgtttgggagagctggacgctggaggggtctttactggattgttgcaagttggtc
aaccgcaaaattccttcggttgtattggaggtctatattgaaatcctcgcagctgtgagt
gaagaagatggtgtcactagatggctagattga

DBGET integrated database retrieval system