KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349275Help
Entry
4349275           CDS       T01015                                 

Definition
(RefSeq) probable protein phosphatase 2C 72
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C SpoIIE PP2C_2
Motif
Other DBs
NCBI-GeneID: 4349275
NCBI-ProteinID: XP_015614210
UniProt: Q7XCJ7
Position
10
AA seq 393 aa AA seqDB search
MLSAAMEYLRSCWGPASSPAGRPRKGSDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNL
LEDHSQVESGPLSTTDPNLQGTLVGVYDGHGGPETARYINDHLFNHLRGFASEHKCMSAD
VIRKAFRATEEGFFSVVSSQWSMRPQLAAVGSCCLVGVICAGNLYIANLGDSRAVLGRLV
KGTGEVLAMQLSAEHNASFEEVRRELQAAHPDDPHIVVLKHNVWRVKGIIQITRSIGDVY
LKKPEFNREPLHSKFRLQETFRRPLLSSEPAIVVHQLQTTDQFIIFASDGLWEHISNQEA
VDLVQHNPRNGIARRLVKAAMQQAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVFFDSN
AITTANWSRPSVSLRGGGVTLPANSLAPFSVPT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgctatctgctgcgatggaatacttgagatcttgctggggcccggcgtcgtcgccggcc
gggcgcccccgcaaaggatcggatgcggcggggcggcaggatgggctgctgtggtacaag
gacgccggccagctcgtcgccggcgagttctcgatggccgtggtccaggccaacaacctg
ctcgaggaccacagccaggtggaatccgggccactgagcaccacggatcccaacctgcag
ggcactcttgtgggcgtctatgatgggcatggaggcccggagacggcgcgctacatcaat
gaccatctcttcaaccatctgaggggatttgcttctgagcacaagtgcatgtcagcggat
gtgattcggaaggcgtttcgagcaactgaggagggattcttttctgtagttagtagtcaa
tggtcgatgaggcctcaattagcggcagtaggctcttgctgtctggttggtgtgatctgt
gctggaaatctatatattgcaaaccttggcgattcccgtgctgttctcggtagacttgtg
aagggaactggggaggttctggctatgcagttgtcagcagaacacaatgcatcctttgaa
gaggtcaggcgagagctgcaggcagcacatcctgatgatccccatattgtggttctaaag
cacaatgtttggcgtgtgaagggtattatccagataacaagatccattggagatgtgtat
ctgaagaaaccggagttcaacagagaacctttgcatagcaaatttcggcttcaagaaact
ttcaggaggcctcttcttagttctgaaccagctattgttgtacaccaattacagacaact
gatcagttcatcatttttgcatctgatggactatgggagcatattagtaatcaggaagca
gttgatcttgtccaacataatccccgcaatgggattgctagaagactagtaaaggctgca
atgcagcaggcagcaaaaaagagggagatgaggtattcagatctgaagaaaattgatcgt
ggggtaaggcggcacttccatgatgatataacagttgttgtggtgttctttgattcgaat
gccataaccactgctaactggagccgaccttcagtttctcttcgagggggtggtgttact
ctccctgcaaattcccttgctccattctcagttcctacatag

DBGET integrated database retrieval system