KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350002Help
Entry
4350002           CDS       T01015                                 

Definition
(RefSeq) protein disulfide isomerase-like 1-1
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4350002
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4350002
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   4350002
Membrane trafficking [BR:osa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    4350002
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4350002
  Exosomal proteins of colorectal cancer cells
   4350002
  Exosomal proteins of bladder cancer cells
   4350002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_2 Thioredoxin_8 OST3_OST6 AhpC-TSA ERp29_N Redoxin TraF Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 4350002
NCBI-ProteinID: XP_015617314
UniProt: Q53LQ0
Position
11
AA seq 512 aa AA seqDB search
MAISKAWISLLLALAVVLSAPAARAEEAAAAEEGGDAAAEAVLTLDADGFDEAVAKHPFM
VVEFYAPWCGHCKKLAPEYEKAAQELSKHDPPIVLAKVDANDEKNKPLATKYEIQGFPTL
KIFRNQGKNIQEYKGPREAEGIVEYLKKQVGPASKEIKSPEDATNLIDDKKIYIVGIFSE
LSGTEYTNFIEVAEKLRSDYDFGHTLHANHLPRGDAAVERPLVRLFKPFDELVVDSKDFD
VTALEKFIDASSTPKVVTFDKNPDNHPYLLKFFQSSAAKAMLFLNFSTGPFESFKSVYYG
AAEEFKDKEIKFLIGDIEASQGAFQYFGLREDQVPLIIIQDGESKKFLKAHVEPDQIVSW
LKEYFDGKLSPFRKSEPIPEVNDEPVKVVVADNVHDFVFKSGKNVLVEFYAPWCGHCKKL
APILDEAATTLKSDKDVVIAKMDATANDVPSEFDVQGYPTLYFVTPSGKMVPYESGRTAD
EIVDFIKKNKETAGQAKEKAESAPAEPLKDEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctcgaaggcttggatctcgctgctgctcgcgctcgccgtggtgctgtcggcg
ccggcggcgagggcggaggaggcggcggctgcggaggaggggggcgatgcggcggcggag
gccgtgctgacgcttgacgcggacggcttcgatgaggccgtcgccaagcacccgttcatg
gtcgtcgagttctacgccccgtggtgtggacactgcaagaagctcgctccagagtatgag
aaagctgcacaagagctaagcaagcacgatccaccgattgttcttgccaaggttgatgcc
aacgacgagaagaacaagcctcttgctaccaagtatgagatccagggtttcccgacactc
aagatattcaggaaccagggcaagaacattcaggaatacaagggcccgagggaggctgag
ggcattgttgaatacttgaagaagcaggttggtcctgcttccaaggagatcaagtcacca
gaagacgcaaccaaccttattgatgacaagaaaatctacattgttggaatcttctcagaa
ttaagtggcactgagtatacaaacttcatagaggttgctgagaagctgagatctgattat
gactttggccacaccttgcatgccaaccaccttccacgcggtgatgctgcagttgagaga
ccattggttaggctattcaagccctttgatgagcttgttgttgacagcaaggattttgat
gttactgctttggagaagttcattgatgctagcagcacccctaaagttgttacttttgac
aagaaccctgacaaccatccttaccttctgaaatttttccaaagctcagctgccaaggct
atgctatttttgaacttctccactggaccgtttgagtctttcaagtcagtttattatggt
gctgctgaggagttcaaggacaaggaaattaagttcctcattggtgacattgaggccagt
caaggtgccttccagtactttgggctgagggaggatcaggtaccactcatcatcatccag
gatggtgagtccaagaaatttttgaaggcacacgttgagcctgaccaaattgtttcttgg
ttgaaggaatactttgatggtaaattgtctccattcaggaagtctgaacctattcctgag
gtcaacgacgagcctgttaaggttgtggtcgctgataacgtccatgattttgtcttcaag
tctggcaaaaacgtccttgttgaattctatgcaccatggtgcggacactgcaagaagctg
gctccaatcttggatgaggcagctacgacgcttaaaagcgacaaggatgttgtcatcgct
aagatggatgcaactgcgaacgatgtgccaagcgagttcgatgtgcaaggttaccccacc
ctgtacttcgtcacccccagtggaaagatggttccctatgaaagcggcaggacagccgac
gagatcgtcgacttcattaagaagaacaaggaaaccgctggtcaggcgaaggagaaggca
gagtcggccccagccgagcctctcaaggatgagctctaa

DBGET integrated database retrieval system