KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350053Help
Entry
4350053           CDS       T01015                                 

Definition
(RefSeq) alcohol dehydrogenase 1
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00071  Fatty acid degradation
osa00350  Tyrosine metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4350053
  Lipid metabolism
   00071 Fatty acid degradation
    4350053
   00592 alpha-Linolenic acid metabolism
    4350053
  Amino acid metabolism
   00350 Tyrosine metabolism
    4350053
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     4350053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 4350053
NCBI-ProteinID: XP_015616853
UniProt: Q2R8Z5 B6F2C1
Position
11
AA seq 379 aa AA seqDB search
MATAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT
PVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRINT
DRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCVAKINPAAPLDKVCVLSCGIS
TGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGIDLNANRFEEARKFGC
TEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHK
DAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFSEINT
AFDLMHKGEGIRCIIRMEN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcagggaaggtgatcaagtgcaaagcggcggtggcatgggaggccgcgaag
ccgctggtgatcgaggaggtggaggtggcgccgccgcaggccatggaggtgcgcgtcaag
atcctcttcacctcgctctgccacaccgacgtctacttctgggaggccaagggacagact
cccgtgttccctcggatcttcggccatgaagctggaggtattgtggagagtgttggagag
ggtgtgactgatcttgcccctggtgaccatgttctccctgtgttcactggggagtgcaag
gagtgtgcccactgcaagtcagcagagagcaacatgtgtgatctgctcaggatcaacact
gacaggggtgtgatgattggtgatggcaaatcacgcttttccatcaacgggaagcccatt
taccatttcgtcgggacttcgaccttcagcgagtacactgtcatgcatgttggttgcgtt
gcgaagatcaacccggcagctccacttgataaagtttgcgttcttagctgtggtatttct
actggtcttggtgctacaatcaatgtggcaaagccaccaaagggttcgacggtggcgata
tttggtctaggagctgtaggccttgctgccgcagaaggtgcaaggattgcaggagcgtca
aggatcattggcattgacctgaacgccaacagatttgaagaagctaggaaatttggttgc
actgaatttgtgaacccaaaggaccatgacaagccagttcagcaggtacttgctgagatg
accaatggcggagttgaccgcagcgttgaatgcactggcaacatcaacgccatgatccaa
gcatttgaatgtgttcatgatggctggggtgttgctgttttggtcggcgtgccacacaag
gacgccgagttcaagacccacccgatgaacttcctgaacgagaggactctcaagggaacc
ttcttcggcaactacaagccacgcaccgatctgcccaacgtcgtcgagctctacatgaag
aaggagctggaggtggagaagttcatcacacacagcgtgccgttctcggagatcaacacg
gcgttcgacctgatgcacaagggcgagggcatccgctgcatcatccgcatggagaactga

DBGET integrated database retrieval system