KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350526Help
Entry
4350526           CDS       T01015                                 

Definition
(RefSeq) DNA replication licensing factor MCM2
  KO
K02540  DNA replication licensing factor MCM2 [EC:3.6.4.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Module
osa_M00285  MCM complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4350526
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4350526
   03036 Chromosome and associated proteins [BR:osa03036]
    4350526
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     4350526
DNA replication proteins [BR:osa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    4350526
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    4350526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCM MCM_OB MCM2_N MCM_lid MCM_N Mg_chelatase AAA_5 AAA_3 Sigma54_activat AAA_lid_2 Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 4350526
NCBI-ProteinID: XP_015615188
UniProt: Q2R482
Position
11
AA seq 961 aa AA seqDB search
MDDSENNAPSTPGSPGFSTDRLPPNTTTSRGATDPSSYSDDDDDDVVGAEEAEVDPNVLP
EDDGVVAAEEEEDGEDLFNDNYLDDYRRMDEQDQYESVGLDDSIEDERNLDEIMADRRAA
EAELDARDVRTGAAPDRKLPRMLHDQDTDEDMSFRRPKRHRANFRPPREPRTPRSDDDGD
GATPSSPGRSQRGMYSGGDVPMTDQTDDDPYEDEFDEEDEMNMYRVQGTLREWVTRDEVR
RFIAKKFKEFLLTYVNPKNEQGEFEYVRLINEMVLANKCSLEIDYKQFIYIHPNIAIWLA
DAPQSVLEVMEEVAKNVVFDLHKNYRNIHQKIYVRITNLPVYDQIRNIRQIHLNTMIRIG
GVVTRRSGVFPQLQQVKFDCSKCGTVLGPFFQNSYTEVKVGSCPECQSKGPFTINVEQTI
YRNYQKLTLQESPGIVPAGRLPRYKEVILLNDLIDCARPGEEIEVTGIYTNNFDLSLNTK
NGFPVFATVVEANYVAKKQDLFSAYKLTDEDKAEIEKLAKDPRIGERIVKSIAPSIYGHE
DIKTAIALAMFGGQEKNVKGKHRLRGDINVLLLGDPGTAKSQFLKYVEKTGHRAVYTTGK
GASAVGLTAAVHKDPVTREWTLEGGALVLADRGICLIDEFDKMNDQDRVSIHEAMEQQSI
SISKAGIVTSLQARCSVIAAANPIGGRYDSSKTFTQNVELTDPIISRFDVLCVVKDIVDP
FTDEMLARFVVDSHARSQPKGANLEDRVPTDVEDDPLAAARQADPDILSQDMLKKYITYA
KLNVFPKIHDADLDKISHVYAELRRESSHGQGVPIAVRHIESIIRMSEAHARMHLRSYVS
QEDVDMAIRVLLDSFISTQKFGVQKALQKNFRKYMTYKKDYNELLLLLLRTLVKDVLHFE
EIVSGPTTRLTHIEVKVEDLKNKAQEYEIYDLRPFFSSAHFRDNNFVLDEGRGIIRHPLA
A
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggatgactcggagaacaacgcgccgtcgacgccggggtcgccggggttcagcacagac
aggctgccgccgaacaccaccaccagccgcggcgccaccgacccgtcctcctactcggac
gacgacgacgacgacgtggttggcgcggaggaggcggaggtcgaccccaacgtgctcccc
gaggacgacggcgtcgtcgccgccgaggaggaggaggacggggaggacctcttcaacgac
aactacctcgatgattaccggaggatggatgagcaggaccagtatgaatcggttgggtta
gatgactcgatagaggatgaaaggaacctggatgagatcatggcagatagaagggctgct
gaagcagaacttgatgcaagggatgtgaggactggtgcagcacctgataggaaattgcca
cggatgctacatgatcaagacacagatgaggatatgagcttcaggcgtcctaaaaggcac
agagctaattttagaccaccaagggaaccaagaacaccaagaagtgatgatgacggtgat
ggtgccacgcctagttcacctggaagatctcagcgtggaatgtattctggaggggatgta
cctatgactgaccagactgatgatgatccatatgaggatgaatttgatgaagaagatgag
atgaacatgtaccgtgtacaaggaactcttagagagtgggtcacaagagatgaagtccgc
cgctttatcgcaaagaagttcaaagaattccttctaacatatgtaaacccaaagaatgaa
caaggagagtttgagtatgttcgactaatcaatgagatggttctagctaacaaatgcagc
ttagagatagattacaagcaatttatttatatacatccaaacattgctatatggttggct
gatgcacctcaatcggtgctagaagttatggaggaagttgccaaaaatgttgtttttgat
ctccataagaactataggaacattcatcaaaaaatctatgtccgaataaccaatcttcct
gtctacgaccaaatacgcaatatcaggcaaatccatctgaacacaatgattcgaattggt
ggtgttgttactcggagatcaggtgtttttcctcagctacaacaggtcaagtttgactgc
agcaaatgtgggactgtcctgggccccttcttccagaactcttacactgaagtcaaggtt
ggatcctgccctgagtgccaatccaaagggccattcaccatcaatgttgagcaaaccata
tataggaactaccagaaactcactcttcaggaaagcccaggaattgttcctgctggcagg
cttccaagatacaaggaagtgatacttctgaatgatttgattgactgtgctcgaccagga
gaggaaattgaggtcactgggatatacaccaacaattttgacttgtctttgaatacaaag
aatggtttcccagtttttgccacagtagtggaggcaaactatgtggcaaaaaaacaggat
ctgttctctgcttacaaattaactgatgaggacaaggcggagattgagaagttggcaaaa
gatccacggatcggtgaaaggattgtcaaatcaattgcaccatccatatatggtcatgaa
gatatcaagactgccattgcactagctatgtttggggggcaagagaagaatgtcaaggga
aagcatcgcttgagaggagatatcaatgtactcctcttaggtgatccaggcactgcaaaa
tcccaatttctcaagtatgttgagaaaactggacacagagcagtgtacacaactggaaaa
ggagcttctgctgttggactcaccgcagcagttcacaaggatccagtaacacgggaatgg
acacttgagggtggtgcactagtgcttgctgatagaggcatatgccttattgatgaattt
gataagatgaacgatcaagatagggtgagtattcatgaggccatggagcaacaaagtatc
agtatatcaaaggccggaattgtcacatcccttcaagctcggtgcagtgttattgctgca
gcaaacccaataggaggaagatatgattcatcgaagacattcacccagaatgttgaactg
acggatccaattatttcacgttttgatgtcctttgtgttgtgaaggacattgttgaccca
tttacagatgaaatgcttgcaaggtttgttgtagatagtcatgcaagatctcaacccaag
ggtgctaaccttgaagatagggttccaactgatgttgaggatgatccattggctgctgcc
agacaagctgacccagatatcctttctcaagacatgctgaagaagtacataacttatgcc
aagttgaacgtgtttcccaaaattcatgatgctgacctggacaagattagccatgtttac
gcagaacttcgtcgtgagtcatctcatggtcaaggagtccctattgccgtaaggcatatc
gaatccattattcggatgtcagaggcacatgcaaggatgcatttgaggagctacgtgtct
caggaagatgtcgacatggctatccgcgtcctgcttgactcatttatttcaactcagaag
tttggtgtacagaaagcacttcaaaagaatttcaggaaatacatgacctataagaaggat
tacaatgagctgctcttgcttcttctgcgcaccctggtcaaggatgtgctgcacttcgaa
gaaatcgtttcaggaccaacgacgcgcctgactcacatcgaggttaaagtagaggacctg
aagaacaaggcccaggagtacgaaatctatgacctgagaccgttcttctccagcgcccac
ttcagggacaacaacttcgtcctcgacgaagggcgggggatcatcaggcaccctcttgct
gcctaa

DBGET integrated database retrieval system