KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351289Help
Entry
4351289           CDS       T01015                                 

Definition
(RefSeq) regulatory-associated protein of TOR 1 isoform X2
  KO
K07204  regulatory associated protein of mTOR
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:osa00001]
 Cellular Processes
  Transport and catabolism
   04136 Autophagy - other eukaryotes
    4351289
Membrane trafficking [BR:osa04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    4351289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N WD40 HEAT HEAT_2 HEAT_EZ DUF4042
Motif
Other DBs
NCBI-GeneID: 4351289
NCBI-ProteinID: XP_015620077
UniProt: Q0IQN5 H2KWV1
Position
12
AA seq 1359 aa AA seqDB search
MALGDLMASRLVHSSSSSAAPSAALPNHHTNHLVDDHLPVENGPDPRRDVPDEEPPPPPP
PQVALLPQVVVLCEQRHEGFDEAAAAAAGPSTSGPVSKWRPKDRMKTGCVALVLCLNISV
DPPDVIKISPCARKECWIDPFSMAPPKALETIGKTLHSQYERWQPKARYKLQLDPTLEEV
KKLCNTCRKFARTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPITDLDSWLKTPS
IYVFDCSAAGMIVKAFLERLDWSSSSSASSSKDCILLAACEAHQTLPQSAEFPADVFTAC
LTTPIKMALHWFCNRSLLRDSMEHNLIDQIPGRQNDRKTLLGELNWIFTAITDTIAWNVL
PHDLFQRLFRQDLLVASLFRNFLLAERIMRSANCSPISYPLLPPTHQHHMWDAWDMAAEI
CLSKLPQLIADPNAEFQPSPFFTEQLTAFEVWLDHGSEDKKPPEQLPIVLQVLLSQSHRF
RALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAMELRQILVFIWTKILSLDKSCQV
DLVKDGGHAYFIRFLDSLDAYPEQRAMAAFVLAVIVDGHRIGQEACANAGLIDVCLRHLQ
PENPNDAQTEPLLLQWLCLCLGKLWEDFPEAQLLGLQSNAPEIVICLLSEPQPEVRASAV
FALGNLVDIGSPSLNGADDDSDDDEKVRAEINVVRSLLQISSDGSPLVRSEVAVALTRFA
MGHNKHIKSVAAEYWKPQTNSLLKSLPSLANINSSNVYSPSSLIQGSSGLASHIGPVLRV
GSDNSATARDGRISTSSPIATNSIMHGSPQSDDSSQHSDSGILLRENASNGGLNYSRSRP
IDNGIYSQFIATMCNVAKDPYPRIASIGKRALSLIGVEQVSMRNSRLSNGGAHPGETSVP
PSSNFGMARSSSWFDMNSGNFSVAFRTPPVSPPQHDYLTGLRRVCSMEFRPHVLNSPDGL
ADPLLSSSAAPSNMGLYILPQSLIYRWSCGHFSRPLLTGSDDNEEANARREERERIAMDC
IAKCQRSSCKMTSQIASWDTRFELGTKASLLLPFSPIVVAADENEQIRVWNYDDALPVNT
FENHKLSDRGLSKLLLINELDDSLLLVGSSDGNVRIWRNYTQKGGQKLVTAFSSVQGYRS
AGRSIVFDWQQQSGYLYASGDMSSILVWDLDKEQVNTIQSTADSGISALSASQVRCGQFA
AGFLDASVRIFDVRTPDRLVYTARPHAPRSEKVVGIGFQPGFDPYKIVSASQAGDIQFLD
VRRASEPYLTIEAHRGSLTALAVHRHAPVIASGSAKQMIKVFSLEGEQLTIIRYQPSFMG
QRIGSVNCLSFHRYKSLLAAGAGDNALVSIYAEDNYQVR
NT seq 4080 nt NT seq  +upstreamnt  +downstreamnt
atggcattgggggatctcatggcctccaggctcgtccactcctcctcctcctccgccgcg
ccatccgccgccctgcccaatcaccataccaaccacctcgtcgatgaccacctccccgtg
gagaatggaccggaccccaggagggacgtgcccgacgaggagccgccgcccccgccgccg
ccgcaggtcgccttgctgccccaggtggtcgtgctgtgcgagcagcggcacgaggggttc
gacgaggccgccgctgcggcggccgggccctccaccagcgggcccgtctccaaatggcgc
cccaaagaccggatgaaaactggctgtgtggcacttgtgttgtgtttaaacattagtgtt
gatccgccggatgtgatcaaaatctccccttgtgcaagaaaggagtgctggatagatcca
ttttctatggcacctccaaaagcccttgaaactattgggaaaacattacactcacaatat
gagcgctggcagccaaaggctcgttacaagcttcagctggatccgacattagaggaagtt
aagaagctatgtaatacttgccgtaaatttgctagaacagagagagtcctttttcattac
aatggtcatggtgtaccaaagcctacagctaatggggagatttgggtatttaacaagagt
tacacacagtatattccgcttcctattactgatcttgattcatggctgaaaacaccctct
atatatgtttttgactgctcagcagctggaatgatcgtgaaagcttttctggagcgccta
gactggagttctagctcgtctgcatcttcatcgaaggactgcattctccttgcggcctgt
gaggcacatcaaactctcccacagagcgcagaatttcctgctgatgtgttcacagcttgc
ctcaccacacccatcaaaatggcactgcactggttttgtaaccgatcgttactccgtgat
tccatggaacacaatcttatcgaccaaattcctggaaggcaaaatgaccgcaaaactctt
ctaggggagttgaactggattttcactgctatcacagacactattgcatggaatgttctt
cctcatgatctattccaaagacttttcaggcaggatcttttggttgctagtctctttcgc
aacttcttacttgctgagagaatcatgcggtccgcaaattgttccccaatttcataccct
ttgttgccaccaactcatcagcaccatatgtgggatgcatgggacatggctgcagagatc
tgcctttctaagcttcctcaattaattgctgatcctaatgcagagtttcagccgagtcca
tttttcacggagcaattgacagcatttgaagtttggcttgatcatggctctgaagacaag
aaacccccagaacagctacctattgttcttcaggttttgcttagtcagtcacacagattt
agagcacttgttctgcttggaagatttcttgacatgggaccttgggcagttgatttggct
ttgtccgttggcatcttcccttatgtacttaaactgcttcaaacaagtgcaatggagttg
cgccaaattcttgtgttcatatggacaaaaattctctctcttgataagtcatgccaggtt
gacttggtgaaagatggagggcatgcatactttatcaggtttcttgacagtttggatgct
tacccagagcagcgtgcaatggctgctttcgttttagccgttattgtggatgggcatagg
attggtcaagaggcttgtgctaatgcagggcttatagatgtctgcctgagacatctgcaa
cctgaaaatccgaatgatgctcagacagagcctttgctcttgcaatggctttgtttatgc
cttggcaaactttgggaagatttccctgaggctcagttacttggtctgcaatcaaacgca
ccggaaattgttatatgcttattgtcagagcctcaacctgaagtcagagcttctgctgtt
tttgcacttggaaatcttgtggatattggatctccatcactgaatggagctgacgacgat
tctgatgatgatgaaaaggtgagagctgaaataaatgttgtccgaagccttctgcagatc
tcttcagatggtagccctcttgttagatctgaggttgccgtagcgcttacccgctttgca
atggggcacaataaacatatcaaatctgttgccgccgagtactggaaacctcaaaccaat
tcactgctcaagtcattaccatcgttggctaatattaattcgagcaatgtttacagtccc
agcagcttaatacaaggtagcagtggccttgcctcacatattggtcctgttttaagggtt
ggcagtgataacagtgccactgctcgtgatggaagaatctctacgagcagcccgattgca
acaaatagcatcatgcatggttctccacagtcagatgattcttcccaacactctgattca
ggcatattactgagagagaatgcaagtaatggtggtctcaactactcaagatcgaggcct
attgataatgggatctattcccaatttatagcaactatgtgcaatgttgctaaagatcct
tacccaagaattgcaagtattgggaaaagggcattgtccctcataggtgttgagcaagta
agcatgagaaacagtagacttagcaatggaggtgcacacccaggagagacatctgtgccc
ccttcatcaaactttggaatggcacgctcctcttcctggtttgatatgaactctggaaat
ttctcggtggcctttaggactcctcctgttagtccccctcagcatgactacctcacagga
ttgcgccgagtgtgctcgatggagttcagaccacatgttttgaactcacctgatggctta
gctgatccgcttttaagctccagtgcagcccccagcaacatggggctctatatacttccc
caatcattaatttacagatggagttgtggtcacttttctaggccacttctaactggttct
gatgataacgaggaagcaaatgctagaagagaagagcgagaacgaattgcaatggattgc
attgctaaatgccaacgatcatcttgcaagatgaccagccaaattgctagctgggatacg
aggtttgagttgggtacaaaagcatcattgttgttgccattttctcctattgttgttgct
gcggatgaaaatgagcaaatacgagtatggaactatgacgatgcgctgccagtgaatact
tttgaaaaccacaagttatctgacagaggcctatctaaacttttgctgatcaatgagctt
gatgatagcttgttgttagttggctcaagtgatggaaatgtccgcatatggagaaactat
actcaaaagggaggacaaaaacttgtaactgctttttcatcagttcaaggctatcgaagt
gctggtcgcagtattgtatttgattggcagcaacagtcgggttatctgtatgcatctggt
gacatgtcctctatccttgtatgggatcttgacaaggaacaagtcaacaccatccagtca
actgctgatagcgggatttcagctctttctgcatctcaggttcgatgtggccaattcgct
gctggttttcttgatgcatctgttaggatatttgacgtgcgtacacctgataggctagta
tatacagcaagaccacatgccccaagatcagaaaaggttgttggtataggatttcagcct
gggtttgatccctacaagattgtaagtgcatctcaagctggagacattcagttccttgat
gttagaagggcatctgaaccctacctcactattgaagcacataggggttcattaacggca
ttagctgttcatcggcatgccccagttattgcaagcggctcagccaagcagatgatcaaa
gtgtttagtcttgaaggagaacagttgacaataattcgctaccagccatcttttatgggt
caacgaataggcagcgtaaactgcctttctttccaccgatacaaatcactccttgccgct
ggtgctggtgataatgctcttgtttctatctacgcggaggacaattaccaagtacgatga

DBGET integrated database retrieval system