KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351315Help
Entry
4351315           CDS       T01015                                 

Definition
(RefSeq) non-specific lipid-transfer protein 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: Tryp_alpha_amyl LTP_2
Motif
Other DBs
NCBI-GeneID: 4351315
NCBI-ProteinID: XP_015618271
UniProt: Q2QYL3
Position
12
AA seq 121 aa AA seqDB search
MAGARRTMALVALVAVVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSG
VRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgctcgcaggacgatggcgctggttgcgttggtggcggtggtggcggcggcg
gtggtggcggagagggcgtcggcggcggtgagctgcggcgacgtgacgtcgtcgatcgcg
ccgtgcctgtcgtacgtgatggggagggagagctcgccgtcgtcgtcgtgctgcagcggg
gtgaggaccctcaacggcaaggcctcctcctccgccgaccgccgcaccgcctgcagctgc
ctcaagaacatggcctcctccttcaggaacctcaacatgggcaacgccgcctccatcccc
agcaaatgtggcgtctccgtcgccttccccatcagcacctccgtcgactgctccaagatc
aactaa

DBGET integrated database retrieval system