KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351573Help
Entry
4351573           CDS       T01015                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4351573
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4351573
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4351573
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Wnk family
   4351573
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4351573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal OSR1_C Haspin_kinase Seadorna_VP7 APH Choline_kinase Phage_int_SAM_2
Motif
Other DBs
NCBI-GeneID: 4351573
NCBI-ProteinID: XP_015620490
UniProt: Q2QXC6
Position
12
AA seq 417 aa AA seqDB search
MDLVEAEAEEQPPDEDGDEEGYVEADPAGRFIRYDEIVGSGAVKTVYKAFDKLEGVEVAW
SQSRIDDSVMGSSKKMKQLNTEIQLLKTLKHKNIEKMFASWVDGEKKTVNIITELFTSGS
LTQYRRKHKKVNMKAMKRWAIQILTGLEYLHSQKPAIIHRDLKCDNIFINGNHGKVKIGD
FGLATFMQQQKKSIKGTLEFMAPELLTGHYNELVDIYSFGMCMLEMVTCEYPYSECQGMA
HIFKKIDEGKKPAAFYKIKDAEVRSFIENCLAPVENRMSATELLKSSFLQDDDLISVSLV
KNMSEDGQQPVSCMLRKGEFLLTGNVDVASHVDLWLRFPDPSGCFKSVEFPFNLTEDTSL
SVAVEMVEQFGLTQDSRPIIAQLIDAFLVILIPEWTPCVAIRQVVSEGANGLTIEKR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggatctggtggaggcggaggcggaggagcagccgccggacgaggacggcgacgaggag
gggtacgtcgaggcggaccccgcaggccgcttcatccggtatgatgagatcgtggggtca
ggggccgtcaaaacggtctacaaagccttcgataagctggagggtgtcgaggtagcatgg
agccaatcccggatcgatgactctgtcatggggtcctctaagaagatgaagcaactaaac
acagagattcaacttttgaagacactcaagcataagaacattgagaaaatgtttgcttca
tgggttgatggggagaagaagactgttaacataatcacagagttgttcacatccgggagc
ttgacacagtaccgcagaaagcacaagaaagtgaatatgaaggctatgaaacgatgggca
atacagatattaacagggctagaatatctgcacagtcagaagccagcaattatacacagg
gatttaaaatgtgacaatatattcataaatggaaatcatgggaaagtgaagattggtgat
tttggtttggcaacattcatgcagcaacagaaaaaaagtataaaaggcaccttagaattt
atggcaccagagctgttaactgggcattacaatgaattggttgatatatattcatttggg
atgtgcatgcttgaaatggtgacatgcgaatacccatacagtgaatgtcaaggcatggcc
catatattcaaaaagattgatgagggtaagaaaccagctgcgttctacaaaattaaagat
gcagaagtaagatctttcatagagaactgtttagctccagtagagaacagaatgtctgca
acagagctgttgaaaagctctttcctccaggatgatgatcttatctcagtctctctggtc
aagaatatgtctgaagatgggcagcagcctgtcagttgcatgcttcgtaagggcgagttt
ctgctgacaggaaatgttgatgtagccagccatgttgatttatggctaagatttcctgat
cccagcggttgtttcaagagtgttgaattcccattcaatttgactgaagatacaagtctt
tctgtggctgtggaaatggttgagcaatttggactgacacaagacagcagaccgatcatc
gcgcagttgatcgatgcattcttggtcatcctgattcctgaatggacaccgtgtgtcgcc
atccgtcaggtggtttctgagggtgcaaacggcttgacaattgagaagcgctga

DBGET integrated database retrieval system