KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351981Help
Entry
4351981           CDS       T01015                                 

Definition
(RefSeq) lysine-specific demethylase REF6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC JmjN zf-C2H2 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 4351981
NCBI-ProteinID: XP_015620626
UniProt: Q2QTX9
Position
12
AA seq 1366 aa AA seqDB search
MSLQPPAVEPPEWLRTLPVAPEYHPTLAEFADPIAYILRIEPEASRYGICKIVPPLPRPP
EDDTFRRLQAAFAAAASSNGDPSPTFPTRLQQVGLSARNRRAASRRVWESGERYTLEAFR
AKAAEFEPPRHAAPPRNPTHLQLEALFWAACASRPFSVEYGNDMPGSGFASPDELPDAAN
ATDVGETEWNMRVAPRARGSLLRAMARDVAGVTTPMLYVAMLYSWFAWHVEDHELHSLNF
LHFGKAKTWYGVPRDAMLAFEETVRVHGYADDLNAIMAFQTLNEKTTVLSPEVLLSAGVP
CCRLVQKAGEFVITFPGAYHSGFSHGFNCGEASNIATPHWLQVAKEAAIRRASTNCGPMV
SHYQLLYELALSLRPREPKNFYSVPRSSRLRDKNKNEGDIMVKENFVGSVTENNNLLSAL
LDKNSCIIVPNADFFVPSFPVALESEVTVKQRFTAGPCSISQQGAENMAADHVAVDKVTE
IQDMSGSLYPCETSLVGCSNRKLYETKYGQRDAAALCLSTSEIQSRGIDTARSHPAGGIL
DQGRLPCVQCGILSFACVAIIQPREAAVQFIMSKECISSSAKQGGIGASDDTSNWIDQSH
EISPPPGPASGTDDNVKHAVSLAHVSDRCRELYASNTDGCTSALGLLASAYDSSDSDDET
TEDVSKHSKKNDSVNQSTDPQILETSASCSSTVQCQKTNSHLHEEECEARATSLMKPVSH
NSRPISQSNRDTDIDHFIELGKSGTQCSGYLDLVDDLTTSVLKSSSDTCVSAAKASMDPD
VLTMLRYNKDSCRMHVFCLEHALETWTQLQQIGGANIMLLCHPEYPRAESAAKVIAEELG
IKHDWKDITFKEATEEDVKKIQLALQDEDAEPTGSDWAVKMGINIYYSAKQSKSPLYSKQ
IPYNSIIYKAFGQENPDSLTDYGCQKSGSTKKKVAGWWCGKVWMSNQVHPLLAREREEQN
SSVVYGKAMFTTISHGKVQDEASTRCNTSNRTPSRRTSRRKKGVSAEKSKPKNKRSTASD
EASMLCSGLGMNSGVIHDQTENSDDYDKHGNGDEIEEGTNPQKYQQRKLQNVTRKSSSKK
RKDEKRTDSFHELYDEDNGVDYWLNMGSGDDATLGNSRQQSPDPVKVKSGGKLQGKRKSS
KYKSNDDLLNEENKLQKMNKKSSSKKQKNDKINRQLQEDQTEDDHMDHLVDVAVADEVTL
DNEDKITEDKIDDVKVKSRGKSQNGKRKGSKHQATDGLRAGNKVAKFPCDIEGCDMSFST
QQDLLLHKRDICPVKGCKKKFFCHKYLLQHRKVHIDERPLKCTWKGCKKAFKWPWARTEH
MRVHTGVRPYECQEPGCGQTFRFVSDFSRHKRKTGHSSDKRRKNST
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcagccgccggcggtggagccgccggagtggctgcggacgctgcccgtggcg
ccggagtaccacccgacgctggcggagttcgccgaccccatcgcctacatcctcaggatc
gagccggaggcgtcccgctacggcatctgcaagatcgtgcccccgctcccgcggcccccc
gaggacgacaccttccgccgcctccaggccgccttcgccgccgcggcctcctccaatggc
gacccctccccgaccttccccacgcggctccagcaggtcggcctctccgccaggaaccgc
cgcgccgccagccgccgggtgtgggagagcggggagcgctacaccctggaggcgttccgc
gccaaggcggccgagttcgagcccccgaggcacgccgcgccgcccaggaaccccacccac
ctccagctcgaggccctcttctgggccgcctgcgcctccaggcccttcagcgtcgagtac
ggcaacgacatgcccggctccggcttcgcctcccccgacgagctccccgacgccgccaat
gccaccgacgtcggggagacggagtggaacatgcgggtggcgccccgcgcccgggggtcg
ctgctccgcgccatggcccgcgacgtggcgggcgtcaccaccccgatgctgtacgtggcc
atgctctacagctggttcgcctggcacgtggaggaccacgagctccacagcctcaacttc
ctccacttcggcaaggccaagacctggtacggcgtcccccgcgacgccatgctcgccttc
gaggagacggtgcgcgtccacggctacgccgacgacctcaacgccatcatggcctttcaa
acgttaaatgagaagacaactgtcttatctcctgaggtgcttctttctgctggtgttccc
tgctgcagattggttcaaaaagcgggagaatttgttatcacattccctggagcttatcat
tcaggctttagccatggatttaattgtggggaagcatcaaatattgcaactccccattgg
ttacaagtggctaaagaagctgcaatccggagggcttcaactaattgtggtccgatggtg
tctcattatcagctgctttatgagctagcactctcattgcgtccaagggagcctaagaat
ttctattctgttccaagaagctcacgtttaagggacaagaataagaatgaaggtgatata
atggtcaaagaaaattttgttggaagtgtaaccgaaaacaacaatttgcttagcgccctt
ctggataagaattcttgtataattgttccaaacgctgatttcttcgttccatcctttcct
gttgcactggaatctgaagttactgttaaacaaaggtttacagctggtccctgcagtatt
agccagcaaggagcagaaaatatggctgctgatcatgtggctgtagacaaggttacagag
attcaggacatgagtggatccttatatccttgtgaaaccagtcttgtgggctgtagcaat
agaaaactttatgaaacaaaatatggccaacgggatgctgctgctttgtgcttatctact
tcagagattcagagcagaggaattgatacagcaagatcacatccagcaggcgggatctta
gatcaaggacggttgccatgtgtacagtgcggaatactaagctttgcatgtgtagccatc
attcaacctagagaagcagcagtacagtttatcatgtctaaagagtgcatctcatcgagt
gcaaaacaaggaggaattggtgcatctgatgatacctcaaactggattgaccagagtcat
gagattagtcctccaccaggtccagcatctggaacagatgataatgtaaagcatgccgta
agtttggcccatgtctctgatcggtgtagagaactatatgccagcaatacagatggatgc
acctctgctcttgggcttctagcttctgcatatgactcatcagactctgatgatgaaaca
actgaggatgtttcaaaacatagcaagaaaaatgattcagtaaaccaaagcacggatcct
caaatcttggaaacatcagctagctgttccagtacagttcagtgtcaaaagacaaattca
cacttgcatgaagaggaatgtgaggcaagagccacatcattgatgaaacctgtaagccat
aatagtaggcccattagtcagtctaacagggatacagatatcgaccattttatagaactg
ggaaagtcaggaacacagtgttcaggttatcttgatttggttgatgatctaactacatca
gttttaaaatcctcttcagatacttgtgtaagtgcagctaaagcctcaatggatccagat
gttttgaccatgctcaggtacaataaagactcttgcagaatgcatgtgttttgtcttgaa
catgctttggaaacatggacacagcttcaacaaatcggtggtgctaatattatgcttttg
tgccatccagaataccctagagcagagtcagcagcaaaagtcatagcagaagaacttggt
atcaagcatgattggaaagatatcactttcaaagaagcaactgaagaggacgttaaaaag
attcagttggctttacaggatgaagatgctgaacccactggcagtgactgggcagtcaaa
atgggtatcaacatatattacagtgccaaacagagcaaatcaccactttacagcaagcag
ataccatacaattccatcatttataaggcatttggccaagaaaacccagacagtttgaca
gattatggatgtcaaaagtcaggctcaacaaagaaaaaggtggctgggtggtggtgtggg
aaagtttggatgtcaaatcaagttcatccacttctagctcgtgagcgtgaagaacagaac
agtagcgtagtgtacggcaaagcaatgttcactactatttcccatggcaaagtacaagat
gaagcgtcaacaagatgcaatacaagcaaccgaaccccatcaagaagaacatcaagaaga
aaaaagggggtatctgctgagaaatctaaaccaaaaaacaagagatccactgcttctgat
gaagctagtatgctttgcagtggccttggaatgaactctggagttatccatgaccaaact
gaaaactctgatgattatgacaaacatggcaatggagatgaaattgaggaaggaacaaat
cctcagaaatatcaacaacgtaaattgcaaaacgtgaccaggaaatcaagttctaagaag
cggaaggatgagaaaagaacagatagttttcatgaactatatgacgaggataatggtgtg
gattattggcttaacatgggtagtggagatgatgccacactaggtaactctcgacaacaa
agtcctgatccagtgaaagtgaaatctggaggcaaattgcaaggtaagagaaaatctagc
aagtacaagtccaatgatgatttgttgaatgaagaaaataagttacaaaagatgaacaaa
aaatcaagctctaagaagcaaaagaatgataagataaatagacaacttcaagaagatcaa
accgaagatgaccatatggaccacttagttgacgtagcggttgcagatgaagtcacacta
gacaatgaggataaaattacagaagacaaaattgatgacgtgaaagtgaaatctagagga
aaatcgcaaaatggtaagagaaaaggcagcaaacatcaggctaccgatggtttgcgcgct
ggaaataaagtggccaaatttccgtgtgatatagaaggatgtgacatgagcttcagtacc
cagcaggacttgttattgcataagcgtgacatttgtcctgtcaaaggatgcaagaagaag
ttcttctgccacaagtacttgcttcagcaccggaaggtgcatatagatgaaaggccactt
aagtgtacatggaaggggtgtaagaaggcattcaagtggccatgggcgaggacggagcac
atgagagtccatacgggggtaagaccttacgagtgccaggaacctggctgtggtcagaca
ttccgattcgtttcagatttcagccgccacaagagaaagactggccattcctctgataag
agaagaaagaacagtacataa

DBGET integrated database retrieval system