KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352016Help
Entry
4352016           CDS       T01015                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain A, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00532  Photorespiration
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4352016
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4352016
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     4352016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 4352016
NCBI-ProteinID: XP_015619409
UniProt: Q2QTJ7
Structure
PDB: 

Position
12
AA seq 175 aa AA seqDB search
MAPTVMASSATSVAPFQGLKSTAGLPVSRRSNSAGLGSVSNGGRISCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaccgtgatggcctcgtcggccacctccgttgctcccttccaggggctcaaa
tccaccgccgggctccccgtcagccgccgctccaacagcgccggcctcggcagcgtcagc
aacggtggaaggatcagctgtatgcaggtgtggccgattgaaggcatcaagaagtttgag
accctgtcgtacctgccaccgctcacggtcgaggacctcttgaagcagatcgagtacctg
ctccggtccaaatgggtgccttgcctcgagtttagtaaggtcgggttcgtctaccgtgag
aaccacaggtctcctgggtactatgatggcaggtactggaccatgtggaagctgcctatg
ttcggatgcactgatgccacccaggtgctcaaggagctcgaggaggccaagaaggcatat
ccagatgcatttgttcgcatcatcggcttcgacaacgtcaggcaggtgcagttgattagc
ttcatcgcctacaagcccccgggttgcgaggagtccggcggaaactaa

DBGET integrated database retrieval system