KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352563Help
Entry
4352563           CDS       T01015                                 

Definition
(RefSeq) metallothionein-like protein 4B isoform X1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: Metallothio_2 Metallothio_PEC
Motif
Other DBs
NCBI-GeneID: 4352563
NCBI-ProteinID: XP_015619845
UniProt: Q2QNE8
Position
12
AA seq 79 aa AA seqDB search
MSCGGSCNCGSCGCGGGCGKMYPDLAEKITTTTTTATTVLGVAPEKGHFEVMVGKAAESG
EAAHGCSCGSSCKCNPCNC
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcggtggaagttgtaactgcggttcctgcggatgcggcggtggctgcggaaag
atgtaccctgacctggctgagaagatcaccaccaccaccactactgcaaccactgtcctc
ggcgttgcacctgagaaggggcactttgaggtgatggttggcaaggcagctgaatctggt
gaggctgcccatggctgcagctgtggctccagctgcaagtgcaacccctgcaactgctaa

DBGET integrated database retrieval system