KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266372Help
Entry
9266372           CDS       T01015                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial isoform X1
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    9266372
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     9266372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 9266372
NCBI-ProteinID: XP_015650191
Position
8
AA seq 590 aa AA seqDB search
MRWTAFMWEGASRAFNHRPTFTNLVLVLGAASSGGLVAYADSNSDDVVGKPQGPPKKKIV
VLGTGWGGTTFLRNLDSRLYDVQVISPRNYFAFTPLLPSVTCGTVEPRSVVEPIRRILEK
KGGDIKFWEAECFKIDSSNKKIHCRSNIGTNLDGNGEFLVDYDYLVIAVGARSNTFNTPG
VEENCFFLKEVEDAQKIRRNVMDCFERASLPYLDEEERKKNLHFVVVGGGPTGVEFAAEL
HDFVTEDLSKLYPSIQHLVKISLIEAADHILTMFDKRITEFAEDKFGRDGIDVKTGYKVV
KVAKDAITMQNPATGDIAVPYGMAVWSTGIGTRPFISEFMKQIGQGKRRVLATDEWLRVR
ECDGVYAVGDCATINQRRVMDDISEIFRVADKDNSGTLTVKEIQDVLDDIYVRYPQVELY
LKSRQMNGIADLVRTAKGDAEKESVELNIEEFKKALSLVDSQVKNLPATAQVASQQGQYL
ARCFNKMKDAEENPEGPIRIRGEGRHRFRPFRYRHLGQFAPLGGEQTAAQLPGDWISIGH
STQWLWYSVYATKQISWRTRALVISDWSRRFIFGEKKLILISRSLKLQVI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggacggcgttcatgtgggagggcgcgtcgagggcgttcaaccaccgccccacc
ttcaccaacctcgtcctcgtcctcggcgccgccagtagtggaggactagtagcatatgcg
gattccaattcagatgatgttgttgggaagccccagggacctccaaagaagaaaatcgtt
gttcttggcaccggttggggtggcaccacgttcctgaggaatcttgacagcagactgtat
gatgttcaggtcatttcacctcggaattatttcgcattcacgcccctgctcccaagtgtc
acttgtgggacagttgagccaaggagcgttgttgagccgattcgtaggattttggagaag
aaaggtggagatatcaaattctgggaagcagaatgctttaagattgattcatcaaacaag
aagatccattgccggtccaatatagggacaaatcttgatggaaatggcgaattcttggtt
gactacgactatcttgtgatagcagttggagctaggtctaatacatttaacactccaggt
gttgaggagaattgcttctttttgaaggaagtagaggatgcccaaaagatccgaaggaat
gtgatggactgcttcgagagagcaagtcttccttacctggatgaagaagagaggaagaag
aaccttcactttgttgttgtaggtggtggacctacaggcgtggaatttgccgcagagttg
cacgattttgttaccgaagatctatccaagctgtatccttctattcagcaccttgtcaag
atatcactgattgaagctgcagatcacatactgactatgtttgacaagaggattactgaa
tttgctgaggataagtttggaagggatggcattgatgtgaaaactggatacaaagttgtg
aaggttgctaaggatgcaattaccatgcaaaatccagccactggagatatcgcggttcct
tatggaatggctgtttggtccactggtattggtacccggcccttcatttcagagttcatg
aaacaaattgggcagggcaaacggcgtgtactagccactgatgaatggctaagggtccgt
gaatgtgatggtgtttatgctgtaggagattgtgctacgataaaccagcggagagtaatg
gatgatatctcggaaatattcagagtagcagataaagataactctggaaccttgacagtg
aaagaaatccaagatgtcttggatgatatctacgtgagatatccccaggtagagctctat
ctgaagagcaggcaaatgaatggaatcgctgatttagtaaggactgccaaaggtgatgct
gaaaaggaatctgtagaactgaacattgaagaatttaagaaagctctttctcttgttgat
tcgcaagtcaaaaatctgcctgcaactgctcaggttgcttcacagcagggacaatatttg
gctaggtgcttcaataagatgaaggatgctgaagaaaaccctgaaggccccatccgtata
aggggagaaggacgccatcgtttccgccctttcaggtacaggcatttaggccaatttgcc
ccactaggaggtgagcagactgctgcacagctccctggtgattggatctccattggccac
agcacacagtggctctggtattctgtctacgcaactaaacaaataagctggcgcacgagg
gcactggtgatctctgactggagccgtcgctttatcttcggtgaaaaaaaattgatatta
atatcaaggtcactaaaacttcaggtaatatga

DBGET integrated database retrieval system