KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267958Help
Entry
9267958           CDS       T01015                                 

Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:osa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    9267958
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    9267958
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    9267958
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9267958
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     9267958
Protein kinases [BR:osa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   9267958
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     9267958
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9267958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 9267958
NCBI-ProteinID: XP_015639438
UniProt: Q75KK8 B7E979
Position
5
AA seq 542 aa AA seqDB search
MDFFTEYGEGNRYKIEEVIGKGSYGVVCSALDTHTGDKVAIKKINDIFEHVSDATRILRE
IKLLRLLRHPDIVEIKHILLPPSRREFKDIYVVFELMESDLHQVIKANDDLTPEHYQFFL
YQLLRGLKYIHTANVFHRDLKPKNILANADCKLKICDFGLARVAFSDTPTAIFWTDYIAT
RWYRAPELCGSFFSKYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIITDLLGTPSP
ETISRIRNEKARRYLNSMRRKKPIPFTQKFPNADPLAMRLLERMLAFDPKDRPSAEEALA
DPYFKNIANVDREPSAQPITKLEFEFERRRITKEDIRELIYREILEYHPKMLREFLEGTE
STGFMYPSAVDHFKKQFAYLEEHYAKGSTAAPPERQHNSLPRPCVVYSDNRPQSTASVTE
DLSRCLIRDNNLKSQDSASVGASRIPQGAAARPGKAVGSVLRYGNCSTSAAEQQYEQRRV
VRNPAIAPNSSVPLGSSYPRRNQTCKSETGDVERIDSSQTGPPKPYVANKLPATVDGRSG
HW
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggattttttcaccgagtacggtgagggaaacaggtacaagatagaagaggttatagga
aaagggagttatggtgtggtttgctctgctttggacactcacaccggtgataaagttgct
atcaagaaaatcaatgacatctttgagcatgtgtccgatgcaacacggatacttcgcgag
atcaagttgcttagactcctgcgacatccggatatcgtggaaattaagcatattctactt
cctccatcaaggagagaattcaaggatatctacgttgtttttgaactcatggagtctgat
ttgcaccaagttataaaggccaacgatgacttgactcctgaacactaccagtttttcttg
tatcagttgctccgaggactgaaatatatacacacagcaaatgtatttcatcgagatctc
aaaccaaaaaatatcttggcgaatgctgattgtaagctcaaaatatgtgatttcggcctt
gcaagggtagcttttagtgatactccaaccgccatcttctggacggattatattgcaaca
aggtggtaccgagcaccagagctgtgtggatcttttttctccaagtatacaccagcaata
gatatatggagtattggctgcatatttgccgagcttttaaccggaaaacctcttttccct
gggaagaatgtggttcatcaacttgatataattacagatctactaggaacaccttctcca
gaaacaatatctaggattagaaatgagaaggcaagacgttacttgaacagtatgaggcgg
aaaaaacctataccatttacacagaagttcccaaatgcagatccacttgcaatgcggttg
ttagagagaatgttagcttttgatccaaaagatcggccaagtgctgaggaggcgcttgct
gatccttatttcaagaacatagccaatgttgatagagagccttctgctcaacctatcaca
aagctagagtttgagttcgagaggcggagaattactaaggaagatataagggaactcata
tatagagaaattctggagtatcatccaaagatgctgagggagttccttgagggaactgag
tccactggtttcatgtacccaagtgcagtagaccattttaaaaaacagtttgcatacctt
gaagaacattatgccaagggatcaacagcagctccacctgagagacaacataactcatta
ccaaggccttgtgttgtctattcagataaccggccacaaagcacagccagtgtcactgag
gatctttccaggtgtttaatcagagacaacaatctaaaatcacaggattctgcttcagtc
ggtgcaagcagaatccctcaaggtgctgctgcaagacctggtaaagcagttggttcggtg
ctgcgttacggtaactgttcgacatccgctgctgagcaacaatatgagcagcgaagggtt
gttcggaacccagcaattgctccaaacagcagtgttcctctggggagctcataccccaga
agaaaccagacctgcaagagtgaaacaggtgatgttgaaaggatcgattccagccaaacc
ggtccaccgaagccatatgtggcgaacaaactgcctgctaccgtcgatggtcggagtggc
cactggtaa

DBGET integrated database retrieval system