KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268048Help
Entry
9268048           CDS       T01015                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    9268048
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    9268048
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     9268048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H
Motif
Other DBs
NCBI-GeneID: 9268048
NCBI-ProteinID: XP_015647089
Position
7
AA seq 947 aa AA seqDB search
MVSSNMFYRRKRSWRAGDLVSRSTLQLLDFDDGSPPEYAWRRKLSSHANRLKEFNVTFRE
AIKMMKLGLRLWSYIREEASHGRKAPIDPFTRESDKPSASQGVPLGGMGSGSISRGFRGE
FKHWQIIPGSCEMSPVMANQFSIFITRGGNKKYSSVLAPGQHDSLKKSNDDGISSWDWKL
RGDRSTYHALFPRAWTVYDGEPDPELKVSCRQISPFIPHNYQESSLPTSVFVYTIVNTGK
ERAKVSLVMTWANSIGGLSHHSGGHVNEPFIGENGVSGVLLHHKTANNNPPVTFAVAACE
NQNVNVTVLPAFGLSGESSVTAREMWGTLSQDGCFDRDNFSAGPSMPSSLGDTVCAAVCA
STWVEPHGRCTVVFSLAWSSPKVKFKKGNAYYRRYTKFYGTSPRSAINLVQDSLMKYKHW
EEEIDKWQRPILHDERFPEWCVLVHDLPVGCCKAVLSLWYKVTLFNELYFLVAGGTVWID
SASLMADADEMMNSRLSEDNDLPLHHSSRNSAVPLIGFSPHIIDDRENVGKFLYLEGIEY
FMWCTYDVHFYASFALLELFPKIELSIQRDFATAVLREDKSRVRFLADGTWGTRKVIGAV
AHDLGAHDPWHELNAYNIHDTSRWKDLNPKFVLQVYRDFAATGDMSFGKDVWPAVCTAME
YMEQFDHDDDGMIENDGFPDQTYDAWTVRGVSAYCGCLWLAALQTAAALARTLGHHDYAE
RCMLKFAKAKPVFEAKLWNGSYFNYDSGTSYNSRSIHADQLAGQWYTASSGLPPLFDEGR
IKCTLQKIFDYNVMRVKGGRMGAVNGMHPNGKVDETCMQSREIWTGVTYSLAATMLLHGM
DDQAFTTAEGIFTAGWSEEGYGYWFQTPEAWTIDGHYRSLIYMRPLAIWAMQYALSPPRT
ILEAPKVNTMDRTSYISPSTLQFLQDSVRKMTPKNSCFGSSSSNCEC
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcagcaacatgttctaccggaggaagcgctcatggcgtgccggtgatctcgtg
agcaggagcaccctgcaattgctggactttgatgatggctcaccaccagaatatgcttgg
agaagaaaactaagtagtcatgccaatagattgaaggagttcaatgttacctttagagaa
gcaattaagatgatgaaacttggtctgcgcctctggtcatatattcgggaagaagcttct
catggaaggaaagcaccaattgatccattcacgagggagagcgacaaaccttcagcctcg
caaggtgtacctcttggtgggatggggagcggtagcatttcaagagggttcagaggagaa
tttaaacattggcagataatcccaggttcatgtgaaatgtcaccagtcatggcaaaccaa
ttttcgatctttataactcgaggaggaaacaaaaaatactcctctgttttagctcctggt
cagcatgatagtttaaagaaatctaatgatgatggtatatcatcctgggattggaaacta
agaggtgatcgttctacataccatgcgttgtttcctcgagcatggactgtctatgatggt
gaacctgatcctgaattgaaagtatcttgccggcaaatatctccttttattccccataac
tatcaagagagcagtcttcctacctctgtttttgtttacactatagtgaacactggtaaa
gaaagggcaaaagtcagcctcgtaatgacctgggcgaattctattggagggctttcccat
cattccggcggtcatgtaaatgagccatttataggagaaaatggagtttctggcgtgctt
ctgcatcacaagactgccaacaataatcctcctgtaacttttgctgttgcagcatgtgag
aaccaaaatgtaaatgtcactgtgttgcctgcttttgggctttctggagaaagttctgtt
acagctagggaaatgtggggcacattgagccaggatggttgcttcgaccgagataatttc
agtgccggccctagcatgccttcttcgctgggtgatacagtttgtgcagcagtttgtgca
tccacctgggttgaaccacatggaagatgtacagtcgtattttccctggcttggtcatcc
cctaaggtcaaatttaagaagggaaatgcatactacaggaggtatacaaaattttatgga
acttctccaaggtcagctataaacttggtgcaagattctttgatgaagtataagcactgg
gaagaggaaattgataagtggcagaggccaattctccatgatgagaggtttccggagtgg
tgtgtacttgtacatgacttaccagttggctgctgcaaggcagtattatccttgtggtac
aaggttactctcttcaatgagctgtacttcctagttgctggaggaactgtttggatagat
agtgcatctttgatggctgatgctgatgaaatgatgaactcaaggctatctgaggacaat
gatttgccacttcatcatagcagtcgcaattctgcagttccactcattggttttagccca
catataattgatgacagggaaaatgtagggaagtttttatacctggaaggaatagagtac
ttcatgtggtgcacttatgatgtacacttctatgcctcttttgctcttctggaactgttt
cctaagattgagctgagcattcaacgtgattttgctacagctgttctgcgcgaagataaa
agtagagtcaggtttcttgctgatggtacttggggcactcgcaaagtaatcggtgctgtt
gcccatgaccttggggcccatgatccttggcatgaattgaatgcgtacaacatacatgac
acaagtagatggaaagatctcaatcccaagttcgtgctacaggtttacagagatttcgcg
gcaacaggtgacatgtcatttggcaaggatgtctggcctgcggtttgtactgctatggag
tacatggaacagtttgaccatgacgatgatggtatgattgagaatgatggctttcctgat
caaacatatgatgcttggacagttcgtggagtaagtgcctactgtggttgcctttggctt
gctgcccttcaaactgcagcagcgctggcccgcacccttggacaccatgattatgctgag
aggtgcatgttgaagtttgcaaaagctaagcccgtatttgaagcaaagttatggaatggt
tcatattttaattatgacagcggaacaagttacaacagtcgctccatccatgcggatcaa
ctggctggacaatggtatactgcatcgtcaggtttgccgcctctgtttgatgagggtagg
ataaaatgcacccttcagaaaatatttgactataatgtgatgagggtaaaaggagggcgt
atgggagctgtgaacggtatgcatccaaatggtaaggtagacgagacttgtatgcagtca
agagaaatctggacaggagtaacgtacagtttagctgctactatgctgctccatggaatg
gacgatcaggctttcactactgcagaaggcattttcaccgcaggatggtccgaagaaggc
tatgggtactggttccaaacccctgaagcatggacgatcgacggccactacaggtcgctg
atatacatgcggccccttgcaatctgggcaatgcagtatgcattgtctcctccaagaacc
atactcgaggcgccgaaggtgaacaccatggacaggacctcctacatctcgcccagcacg
ctccagttcctgcaggacagcgtcaggaagatgacgcccaagaacagctgcttcgggagc
agctcgtctaactgcgaatgctga

DBGET integrated database retrieval system