KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268311
Entry
9268311           CDS       T01015                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    9268311
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     9268311
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 9268311
NCBI-ProteinID: XP_015610613
UniProt: B7F9K3 B9G552
Position
9
AA seq 369 aa
MDAAAVAASLVPSWSAVLVLFSYLGYLAAAGAVLPGKLVPGAVLPDSSRLHYRCNGLLSL
LLLLVLSALGVYMGWMSPTVIADRGIELLSTTFIFSVIVTFLLYYSGLRSHHKSSSLKPH
ITGNFIQDWWLGVQLNPHFMGVDLKFFFVRAGMMAWLFINLSLFAKSYLAGSANLSVILY
QFFCAWYIVDYFVHEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFTIQGWWLLRNKVELS
LLAAVVNCFIFVIGYLVFRGANKQKHIFKKNPKALIWGKPPKLVGGKLLVSGYWGIARHC
NYLGDILLALSFSLPCGTSSVIPYFYPTYLFILLIWRERRDEARCSEKYKEIWVEYCKLV
PWRIFPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggacgccgccgcagtcgccgcctcgctggtgccctcgtggagcgcggtgttggtgctc
ttctcctacctaggctacctcgccgccgccggcgccgtcctccccggcaagctcgtcccc
ggagccgtcctcccggactcgtcccgcctccactaccgctgcaacggtttgctctcgctc
ctcctcttgctggtgctctccgcgctcggtgtctacatgggatggatgtcccctacggtc
attgctgaccgtggaatcgagctgttgtctacaaccttcatttttagtgttattgttacc
ttcttactgtattattcaggattaaggtcccatcataaaagttcttccttgaaaccgcat
atcactgggaacttcatacaagattggtggttgggagtgcagctcaatcctcatttcatg
ggagttgacctcaagttcttttttgtgagagctgggatgatggcatggttatttatcaac
ctatctttgtttgcaaagagctacctagctggttcagccaatctttcagtcattctctac
caattcttttgtgcgtggtatattgtagattacttcgttcatgaagaattcatgacttca
acatgggacattattgcggaaaggctgggtttcatgctggtctttggtgatctagtgttc
attccatttaccttcaccattcagggatggtggcttttgagaaacaaagtggagctgtcc
cttttggctgctgtagttaactgcttcattttcgttattggctatcttgtgttcagagga
gccaacaaacaaaaacatatcttcaagaagaaccctaaagctcttatttggggtaaacct
cccaaacttgtcggggggaagctacttgtatctggctactggggaattgcaaggcactgc
aattatcttggggatatactgctagctctttcatttagcttaccctgtggaaccagttcg
gtgatcccatacttctacccaacatacctgttcattttgctgatatggagggaacgaagg
gacgaagcaaggtgctcagagaagtacaaggagatctgggtagaatattgcaagcttgtg
ccttggaggatctttccttacgtgtattaa

DBGET integrated database retrieval system