KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270250
Entry
9270250           CDS       T01015                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase 1, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00906  Carotenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    9270250
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     9270250
SSDB
Motif
Pfam: RPE65
Other DBs
NCBI-GeneID: 9270250
NCBI-ProteinID: XP_015618707
UniProt: Q5MBR3
Position
12
AA seq 613 aa
MPTTFTPNSPASSCSIHHRASPSRGARNSVRFTRPRAAAAATNSVLSAPSSVPPAYVPPP
PPPPTKMFPEAGDAAAAKAAARRCGKKKDGLNFFQRAAAVALDAFEEGFITNVLERPHAL
PRTADPAVQIAGNFAPVGEQPPVRSLPVSGRIPPFINGVYARNGANPHFEPTAGHHLFDG
DGMVHAVRIRNGAAESYACRFTETARLGQERALGRAVFPKAIGELHGHSGIARLALFYAR
GLCGLVDPSHGTGVANAGLVYFNGRLLAMSEDDLPYQVRVTADGDLETVGRYDFDGQLGC
AMIAHPKLDPVSGELFALSYDVIKKPYLKYFYFDADGTKSPDVEIELEQPTMIHDFAITE
NFVVVPDHQVVFKLGEMFRGGSPVVLDREKTSRFGVLPKHATSSLEMVWVDVPDCFCFHL
WNAWEEAESGEVVVVGSCMTPADSIFNESDEHLESVLTEIRLNTRTGESTRRAVLPPAAQ
VNLEVGMVNRAMLGRKTRYAYLAVAEPWPKVSGFAKVDLATGELTKFEYGEGRFGGEPCF
VPMGGAGAAASPARGEDDGYILSFVRDEAAGTSELLVVNAADMRLEATVQLPSRVPYGFH
GTFINAGELATQA
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgccgaccaccttcacgcccaattcccccgcctcctcgtgttccatacaccaccgcgcc
tccccgtcgaggggtgcccgcaattcggtgcggttcacgcgcccgcgcgccgccgccgcg
gcgacgaactcggtgctcagcgcgccgtcgtccgtgccgcccgcgtacgtgccgccgccg
ccgccgccgccgaccaagatgttcccggaggcgggcgacgcggcggcggccaaggctgcg
gcgaggaggtgtggcaagaagaaggatgggctgaacttcttccagcgcgcggcggcggtg
gcgctcgacgcgttcgaggaagggttcatcacgaatgtgctggagaggccgcacgcgctg
ccgcggacggccgacccggcggtgcagatcgccgggaacttcgcgccggtgggggagcag
ccgccggtgcggtcgctcccggtgtccggccgcatcccgcccttcatcaatggcgtctac
gcccgcaacggcgccaacccgcacttcgagcccaccgcgggccaccacctgttcgacggc
gacggcatggtccacgccgtccgcatccgcaacggcgccgccgagtcctacgcctgccgc
ttcaccgagactgcgcgcctcggccaggagcgcgccctcggccgcgccgtcttccccaag
gccatcggcgagctccatggccactccggcatcgcccgcctcgccctcttctacgcgcgg
gggctctgcggcctcgtcgacccgtcgcacggcaccggcgtcgccaacgccggcctcgtc
tacttcaacggccgcctcctcgccatgtccgaggacgacctcccgtaccaggtccgcgtc
accgccgacggcgacctcgagacggtggggcgctacgacttcgacggccagctcggctgc
gccatgatcgcccaccccaagctcgacccggtctccggcgagctcttcgccctcagctac
gacgtgatcaagaagccatacctgaaatacttctacttcgacgccgatggcaccaagtca
cccgacgtcgagatcgagcttgagcagccgacgatgatccacgacttcgccatcaccgag
aacttcgtggtggtacccgaccaccaggtggtgttcaagctcggcgagatgttccgcggc
ggctcgccggtggtgctcgacagggagaagacgtcgcggttcggcgtgctccccaagcac
gcgacgagctcgttggagatggtgtgggtcgacgtccccgactgcttctgcttccacctg
tggaatgcgtgggaggaggccgagtccggcgaggtggtggtggtgggatcctgcatgacg
cccgccgactccatcttcaacgagtcggacgaacacctcgagagcgtgctcaccgagatc
cgcctcaacacgcgcaccggcgagtccacccgccgcgccgtgctgccgccggcggcgcag
gtgaacctcgaggtcggcatggtgaaccgcgccatgctcggccggaagacgaggtacgcc
tacctcgccgtcgccgagccgtggcccaaggtgtccggcttcgccaaggtggacctcgcc
accggcgagctcaccaagttcgagtacggcgagggccggttcggcggcgagccgtgcttc
gtgcccatgggcggcgccggcgccgccgcgtccccggcgcgcggcgaggacgacggctac
atcctctccttcgtccgcgacgaggccgcgggcacatccgagctcctcgtcgtgaacgcc
gccgacatgaggctggaggccaccgtccagctgccgtcgcgcgtcccctacggcttccac
ggcaccttcatcaacgccggcgagctcgccacgcaggcctag

DBGET integrated database retrieval system