KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270393
Entry
9270393           CDS       T01015                                 

Definition
(RefSeq) uncharacterized protein LOC9270393
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: DUF1719 Rx_N
Other DBs
NCBI-GeneID: 9270393
NCBI-ProteinID: XP_015615634
UniProt: Q2R4W1 C7J881
Position
11
AA seq 450 aa
MQRPSVVEIVGSAVVGEAVGRICSYLISRGEEEVAAGDGAEHDEERMEVALLRIQAAVEE
ADGWHITNRPLVRWRDKLKRAADEGECVLREYRRRRRRRLCVADDDARRLWFPRRVARAA
GKKLFAFGGGDEQRLSGGTVRRFERLADGVGDFVKLVESGGRAKRFVPFQPVAASLLARR
AVSFSVKPPASPGATAHAFAFPDLTSPWRRPRAHVVFLYADGGGTGEKLELFVELDLSES
ADVMALALSSMDALPPHFRFASAAAFGSFHRLQAMTQDDGGGDHLPAWDAHYCSQPSRYE
QPEWMAAGYGDEPASVAALPEHVLYVVAEWDSPARDAPRTTPPPPPPVHVSYHLGRQGAD
WAVRREEMARRIMDGRFGTRARRVERHVDAGAETFNGVVMCTVDGFRRRSEAAVAVAGQV
VRWCFVSGWVVYLSVRGVGAGQPYEVGFQG
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgcagcgaccgtcggtggtggagatcgtcggctcggcggtcgtcggcgaggccgtcggc
cggatatgctcgtacctcatcagccgcggtgaggaggaggtggccgccggcgatggagcc
gagcatgacgaggagaggatggaggtggcgctgctcaggattcaggccgccgtcgaggag
gccgacggctggcacatcaccaaccgcccgctcgtgcggtggcgcgacaagctcaagcgc
gccgccgacgagggcgagtgcgtcctgcgggagtacaggcggcggcggcggcggcgcctg
tgtgtcgccgatgatgatgcgcgccgcctttggtttccgaggcgcgttgctcgggccgcc
ggcaagaagctcttcgccttcggcggcggagacgagcagcggctgagcggcggcaccgtg
cggcggttcgagcggctggcggacggcgtcggcgacttcgtgaagctcgtcgagagcggc
ggccgcgccaagcggtttgtgccgttccagccggtcgcggcgtcgctgctcgcgcggaga
gcggtgagcttctccgtcaagccgccggcgtcgccgggcgccacggcgcacgcgttcgcg
ttcccggacctcacatcaccgtggcgccgcccgcgcgcgcacgtcgtgttcctgtacgcg
gacggcggcggcaccggcgagaagctggagctgttcgtggagctcgacctctctgagagc
gctgacgtcatggcgctcgctctgtcctccatggacgcgctgccgccgcacttccgcttc
gcctccgccgccgccttcgggagcttccaccgcctgcaggccatgacgcaggacgacggc
ggcggcgaccacctcccagcgtgggacgcgcactactgcagccagccgtcccggtacgag
cagccggagtggatggccgccggatacggcgacgagccggcatcggtggcggcgctgccg
gagcacgtcctctacgtggtcgccgagtgggacagcccggcgagggacgcaccgcgcacg
acgccgccgccgccgccgcccgtccacgtgagctaccacctcgggcggcagggcgcggac
tgggcggtgcggcgggaggagatggcgaggcggatcatggacggccggttcgggacgcgc
gcgcggcgcgtcgagaggcacgtggacgccggcgcggagaccttcaacggggtggtgatg
tgcacggtggacggcttccgccggcgaagtgaggcggcggtggcggtggcggggcaggtg
gtgcggtggtgcttcgtgtccgggtgggtggtgtacttgtccgtccggggcgtcggcgcc
ggacagccgtacgaggtaggcttccaaggatga

DBGET integrated database retrieval system