KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270894Help
Entry
9270894           CDS       T01015                                 

Definition
(RefSeq) serine decarboxylase 2
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00340  Histidine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    9270894
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     9270894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 9270894
NCBI-ProteinID: XP_015613225
UniProt: Q8RV06
Position
10
AA seq 467 aa AA seqDB search
MVLLNSEEVSCNDHHQVDVVAAAGLQCSGDMLGDKQLVSQVILEGLEIEEPPADEMEAAE
KKAGISRLMAGYVQHLQHRSAYHLGYPLNFDYDFSPLAPFLNFSLNNAGDPFAKVNNSVH
SRQFEVAVLNWFANFWDVQRDQFWGYITSGGTEGNLYGLLVGRELFPDGILYASNDSHYS
VFKAAKMYRVKCIRIATTVSGEMNYADLKSKLQHNTNSPAIINANIGTTFKGAVDDIDQI
ISTLEKCGFQNRYYIHCDSALSGMMTPFMKQAPKVSFKKPIGSISVSGHKFLGCPMPCGV
VITRLEHAEVLSTDIEYIASRDSTITGSRNGHAPIFLWYTLSKKGYKGLLKEVHICMGNA
RYLEVLLKQVGISASCNTLSNIVVFERPKDERIVCRWQLACEGNLAHIVVMPNVTFEKLT
VFVEELAEKRKDWYQDKGFDIPCLAVDIGKENCYCNLHAKKLRIPKM
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtactgttgaattcagaagaagtctcttgcaatgatcatcatcaggtagatgttgtt
gcagcagccgggctgcagtgcagtggtgacatgctgggagacaagcagcttgtaagccaa
gtgatattggaaggtttggagattgaagagcctcctgcagatgagatggaggctgcagag
aagaaggcagggatatctaggttaatggctggctatgtgcagcacctccaacataggtct
gcctaccatctcggttatccactcaactttgactacgactttagccccctcgcacctttt
ctgaacttttccctcaataatgctggtgatccatttgctaaggtcaacaacagtgttcac
tcaagacaatttgaagttgcagtattgaattggtttgctaatttttgggatgtacaaaga
gaccaattctggggatacatcactagtggtggaacggaagggaacttatatgggctattg
gttgggagagagctttttcccgatgggatcttgtatgcttcaaatgattcacattactct
gtcttcaaggcagctaaaatgtatagagttaagtgcatcaggattgccactacagtttct
ggagagatgaattatgcagacttaaaatctaagctacaacataacaccaacagcccagca
attataaatgccaatattggtactacctttaaaggagctgtagatgatatcgaccagata
ataagtacacttgaaaaatgtggatttcaaaatcgttactacattcattgtgacagcgct
ctctctggaatgatgacgccctttatgaaacaagccccaaaggtgtcattcaaaaaacca
attggctctatcagcgtgtcagggcacaaattcttgggttgtccaatgccatgtggtgta
gtcatcaccaggttggaacatgccgaagtcctgtcaacagatattgagtacatagcttct
agggattccactatcactggaagccgaaatggtcatgctccaatcttcctctggtataca
ttaagcaaaaaagggtacaaaggacttctgaaagaagtacacatatgtatgggaaatgca
cgatacctcgaggtattattgaaacaagttggtataagcgcatcttgcaatacattaagc
aacatagtggtgtttgaaaggccaaaggatgaaagaattgtgtgtaggtggcaacttgct
tgtgagggaaatttagcacatattgttgtgatgccaaatgtcacttttgaaaagctcaca
gtttttgttgaagagcttgctgagaagagaaaagattggtatcaggacaagggattcgat
attccatgccttgcggttgacattggcaaggaaaattgttattgcaacctgcacgcaaaa
aagttaagaattcctaaaatgtga

DBGET integrated database retrieval system