KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271186Help
Entry
9271186           CDS       T01015                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member H1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00053  Ascorbate and aldarate metabolism
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00330  Arginine and proline metabolism
osa00340  Histidine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00561  Glycerolipid metabolism
osa00620  Pyruvate metabolism
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9271186
   00053 Ascorbate and aldarate metabolism
    9271186
   00620 Pyruvate metabolism
    9271186
  09103 Lipid metabolism
   00071 Fatty acid degradation
    9271186
   00561 Glycerolipid metabolism
    9271186
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    9271186
   00310 Lysine degradation
    9271186
   00330 Arginine and proline metabolism
    9271186
   00340 Histidine metabolism
    9271186
   00380 Tryptophan metabolism
    9271186
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    9271186
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    9271186
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     9271186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 9271186
NCBI-ProteinID: XP_015618174
UniProt: Q2QWY3
Position
12
AA seq 484 aa AA seqDB search
MAAARSVGMEAEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEVCRALHADLAKP
YTESYVHEIALVKSSCKFALKNLKKWMKPQKVTAPLMTFPSTARVAAEPLGVVLVISAWN
YPFLLSIDPIIGAIAAGNAVVLKPSEVAPATSSLLAELLPRYVDGSCIKVVEGGVAETTT
LLEQKWDKIFYTGNGKVGRIVMASAAKHLTPVVLELGGKCPVVVDSNVNLHVTAKRIAAG
KWGCNNGQACISPDFIITTKSFAPKLLEALEKVLEKFYGRDPLRSSDLSRIVNSNHFNRL
KKLMDDENVSDKIVFGGQRDEHQLKIAPTIFMDVPLDSGIMKEEIFGPLLPIITVDKIHE
SFALINSMTKALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPFGGVGESGM
GAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGAMIKAILGF
PRGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgaggagcgtggggatggaggcggaggtggcggcgctgcgggggaggttc
gcggcgggggggacgcggggcgcggagtggcgggcggcgcagctccgcgggatcctgcgg
atggcggcggaggcggaggcggaggtgtgccgcgccctccacgccgacctcgccaagccc
tacaccgagtcctacgtccacgagattgcgctggtgaagtcgtcctgcaagtttgccctc
aagaatctgaagaaatggatgaagccccaaaaggtcactgctccgcttatgacgttcccg
tcgacggcgagggtggcggcggagccactcggcgtcgtgctcgtcatctcggcctggaac
taccctttcttgctgtcgatcgacccgatcatcggagcgatcgccgccggcaacgccgtg
gtgctgaagccgtcggaggtggcgccggcgacctcgtcgctgctggccgagctgctgccg
cgctacgtcgacggcagctgcatcaaggtcgtcgagggtggcgtcgccgaaaccaccacc
ctgctcgagcagaaatgggacaagatcttctacacagggaatggcaaggtaggacgcatc
gtgatggcgtcggcggcgaagcacctgacgccggtggtcctggagctcggcggaaaatgc
ccggttgttgtcgactctaatgtcaacctccatgttactgccaagaggatagccgccggg
aaatggggttgcaacaatgggcaggcctgcatttctcctgatttcatcataacaacaaaa
tcattcgccccaaagctgctggaggctctagagaaagttttggagaagttctacgggagg
gacccgctgcgatcatctgacttgtcgcgaattgtgaattccaaccattttaaccggctg
aagaagctgatggacgatgaaaatgtctctgataagatcgtgttcggaggtcagagagat
gaacatcagctaaagatagcccctacaatcttcatggatgttcctcttgattcagggatc
atgaaggaggaaatctttggccccttgcttcctatcataacggttgataagatccatgag
agctttgctctcatcaactccatgacaaaggcacttgcagcctacctcttcaccaaggac
agcaagctccaggaacaatatgaggcagccatctctgcaggaggaatgcttgtcaacgac
acagccgtccacctaacaaaccagtacctaccttttggaggagttggggagagcggcatg
ggagcctaccatggcaggttcagcttcgaggccttcagccacaagaaggccgtgctggtc
cgccgcttcgccggcgaggcggcggcgaggtacccgccgtactcgccggcgaagctcaag
atcctcaggggagtgctcaagggcaacctgggagccatgatcaaggctatcttggggttt
ccaagagggaaatga

DBGET integrated database retrieval system