KEGG   Oceanicoccus sagamiensis: BST96_01935Help
Entry
BST96_01935       CDS       T04832                                 

Definition
(GenBank) carbon-nitrogen hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
osg  Oceanicoccus sagamiensis
Brite
KEGG Orthology (KO) [BR:osg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BST96_01935
Enzymes [BR:osg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BST96_01935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ARN72973
UniProt: A0A1X9NG44
Position
complement(425507..426337)
Genome map
AA seq 276 aa AA seqDB search
MSQYRVSAIQMVSTNNLNENLAEAERLVEAAAAEGAQLIVLPETFAMFSARQQKALGQRE
ASADAVIRPFISALAKRLGIWIVAGTVPVAVADSEQVLSSCFVVDDQGIEQACYNKIHLF
DVDVADSQGSYRESDTFLAGNEAVVIDTPFGRLGLAVCYDIRFPELFRLMFAQGVDIIAV
PAAFTLLTGKAHWLPLLQARAIENQCYIVGANQGGEHTPSRSTSGDSVVIDGWGNIVAKA
DSGPAYIVAEVDTTVLEKQRRAMPIKQHQRFGITAE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatcgagtgtcggctatacaaatggtgagtacaaataacctgaatgagaat
cttgccgaggcagaacgtctagtggaggccgcggcggctgaaggtgctcagttaattgta
ttgccagaaacctttgccatgtttagcgcccgtcagcaaaaggccttgggtcaacgggaa
gcttcagcggatgcagtgatcaggccttttatcagcgctctggccaagcggctgggtatc
tggattgttgccggtacggtgccagtggcagtcgctgatagcgagcaggtattgtcttcg
tgttttgtggtggatgatcagggcatcgagcaagcctgttataacaagattcatttattt
gatgtggatgtggccgactctcagggtagctaccgtgagtcagatacgtttttagcgggc
aatgaggcggtggtgatcgatacccccttcggtcgtttggggttggcggtttgctacgat
attcgttttccagaactgttccggcttatgtttgcccagggcgtcgatattatagcggtg
ccagcggccttcaccctgctaaccggtaaggcccattggttgccgctgttacaggccagg
gcgattgaaaatcaatgttatattgtcggtgctaaccagggcggggagcatacgccatcg
cgcagtacctccggtgattcggtggtgattgatggctggggtaatatcgttgccaaagcg
gatagtgggcccgcttatattgtggcggaggtggatactacagtattggaaaagcagcgc
cgcgctatgccgattaaacagcatcagcgctttgggattaccgcggaataa

DBGET integrated database retrieval system