KEGG   Oceanicoccus sagamiensis: BST96_09305Help
Entry
BST96_09305       CDS       T04832                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
osg  Oceanicoccus sagamiensis
Brite
KEGG Orthology (KO) [BR:osg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BST96_09305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Urease_beta
Motif
Other DBs
NCBI-ProteinID: ARN74303
UniProt: A0A1X9NK09
Position
complement(2031980..2032357)
Genome map
AA seq 125 aa AA seqDB search
MLTDNPISIHVDTQFIPQQSSPEEQRFAFAYTITISNHGVEPVKLISRHWIITDGNAKVE
EVRGDGVVGDQPTIKPGHSYRYTSGALLETAVGTMEGSYQMESASGTAFDAPIPQFSLIH
PGSLH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccgataaccccatcagtattcatgtggacacgcaatttattccacaacagtcc
agcccggaagaacagcgcttcgcttttgcctatacgattaccattagcaaccacggcgtt
gaaccggtaaaacttatcagtcgccattggattattactgacggcaatgccaaagtagaa
gaagtgcgcggcgatggtgttgtcggcgaccaaccgaccattaaacccggccatagctat
cgctataccagcggcgcactattagaaaccgccgttggcaccatggaaggcagctaccag
atggaaagcgcatccggcacggcctttgatgcccccatcccgcaattctcactgattcac
ccggggtcactgcattaa

DBGET integrated database retrieval system