KEGG   Oceanicoccus sagamiensis: BST96_12075Help
Entry
BST96_12075       CDS       T04832                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
osg  Oceanicoccus sagamiensis
Pathway
osg00860  Porphyrin and chlorophyll metabolism
osg01100  Metabolic pathways
Module
osg_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:osg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BST96_12075
Enzymes [BR:osg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BST96_12075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ARN74791
UniProt: A0A1X9NCA0
Position
complement(2639506..2640138)
Genome map
AA seq 210 aa AA seqDB search
MTTAEFQTTTIDILRHGQTVADDILRGRIDVALSDHGYQQMQQRLGPLIEPTAPWQQIIT
SPLQRCAAFADDIKQQHGTPVTINQGFLEMDFGDWDGKPFAELKANDPVLFSKIWRQPHL
YSPPNGEAFTDFSTRIGSAWNSLIEQHCGQHILLICHGGVIRALLGHIMETPLTALSRIE
VPYACLSRVKVHHQQGEDHWPQLIFHNVHQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcagagtttcaaacgaccaccattgatatcttacgccacgggcaaaccgta
gccgacgatattttacgtggccgtattgacgtggccttatccgatcatggctaccagcaa
atgcagcaacggctaggccccctgatcgagcctacagccccctggcagcaaattatcact
tcaccactgcaacgctgcgccgcctttgccgatgatattaagcaacaacatggtacgccg
gtaacaattaatcagggctttctggaaatggattttggtgactgggatggcaaacccttt
gcagaattaaaagctaacgaccctgtactgtttagtaaaatctggcggcagccacacctt
tatagcccacctaacggtgaagcgtttaccgatttttccacccggattggctcggcatgg
aatagcctgatagaacaacattgcggccaacatattttactgatttgtcacggcggggta
atccgcgccctgctagggcatattatggaaacaccactcactgcactatcacgcattgaa
gtaccctatgcctgtttaagccgagtcaaagttcaccaccaacagggtgaagaccattgg
ccacaactaatttttcacaacgtccatcagtag

DBGET integrated database retrieval system