KEGG   Oceanicoccus sagamiensis: BST96_14245Help
Entry
BST96_14245       CDS       T04832                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
osg  Oceanicoccus sagamiensis
Brite
KEGG Orthology (KO) [BR:osg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BST96_14245
Enzymes [BR:osg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     BST96_14245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ARN75174
UniProt: A0A1X9NDP0
Position
complement(3093788..3096007)
Genome map
AA seq 739 aa AA seqDB search
MNNPMITALIAGWLTISLSLPVASQVNSNSLSNPGDEWLNYGRDYTEQRFSPQQQITTDN
VSQLGLAWSFTFPTARVMEATPLIHQGVLYVTTPWSHVFAIDARTGKQRWHYDPNVNKAH
LVNSCCGPANRGAALWSSDGQTRVYVGSFDGRLIAIDSATGKELWSVQTTEPNSHYTITG
APRIIDGKVIIGNGGAELGARGYITAYDAVSGEQLWRFYTVPGNPASPQENQALEAAVDS
WNGEWWKYGGGGTVWDAMAYDPELDLLYIGTGNGSPWNRDIRSPGGGDNLYLNSIVALRP
NSGEYVWHYQVTPKDNWDYTATQHLILAQLTIDGKPRQVIMQAPKNGFFYVLDRRTGELL
SADAYAQVNWASHIDMATGRPIENPVANYQQTGKSVLWPAPFGAHNWQPMAYNPDTQLVY
IPKQHAPGVYQADKKFTFKPNRWNTGTDFTAFSDPKDPMKAKATQDALVRGYLSAWDPIA
RRMRWEVKHPLPVNGGVLATAGGLVFQGTGLGGFHAYDADHGKRLWSFQADSAVLAGPIS
YSLDGEQYIAVAQGSGGSMMMAMGVKFPNASNPAKPKNPNRLLVFKLQATAAEQHSNTTS
QRATPPTIEAHTLSEEDLIAGETLFENNCGFCHGISADASSVVPDLRYMSEESHQNFQAI
VLAGLLTHKGMVGFYANLSPEEVDKIHGYLRQRNHDLHDEIAMDNLWDKLRYWFWYYLSK
LSDLFPALANTEFAKAMAN
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcctatgatcacagcgctaattgctggctggcttactataagcttaagctta
ccagtagccagccaagtcaatagcaacagcctgtccaaccctggcgatgagtggcttaac
tatggccgggattacacagagcaacgctttagcccgcaacagcaaattacgacagacaat
gtcagtcaactggggctagcctggtcttttaccttcccaacggccagagtgatggaagcc
accccgctgatccatcaaggcgtactctatgtcaccactccctggagccatgtctttgcc
attgacgcgcgcacaggcaagcaacgctggcactacgaccccaacgttaataaagcccac
ttagtgaatagctgttgcggccccgccaaccgaggtgccgcactctggtcatcggacggg
caaacccgggtttatgtgggcagttttgatggccgcttaatcgccattgattcagccacg
gggaaagagctctggtcagtacaaaccactgaacccaatagccattacaccattactggt
gctccgcgtattattgatggcaaagtcattatcggtaatggcggcgctgaactgggcgcc
agaggttatatcaccgcttacgatgccgttagcggtgagcaactatggcgcttttatacc
gtccccggcaatcccgccagcccacaagaaaaccaggcccttgaagctgctgttgatagc
tggaacggtgaatggtggaaatacggtggtggcggtacagtatgggatgccatggcttac
gacccggaactcgacctgctttatatcggtaccggcaatggctccccctggaatcgagat
attcgcagtcctggaggcggtgataacttataccttaactccattgttgcgctacggccc
aatagcggcgaatacgtctggcactaccaggttacccctaaagataactgggattacacc
gctacccagcatttgatactggcgcagttaaccattgatggcaaacctcgtcaggtcatt
atgcaagcacccaaaaatggctttttctatgtgctggacaggcgcactggcgaattactc
tccgccgatgcctatgcacaggtgaactgggccagccatattgatatggccaccggcaga
ccaattgaaaacccagtggctaattaccagcaaacaggaaagtcggttctctggcccgcc
ccttttggcgcccacaattggcaacccatggcctataaccccgacacccagttggtctat
atccccaaacagcacgctcccggagtttatcaagccgataaaaaattcaccttcaaaccc
aaccgctggaataccggcaccgattttaccgctttttcggacccgaaagacccgatgaaa
gcaaaggctacacaagacgccctggtgcgcggttacttaagcgcctgggaccctattgcc
agacgtatgcgctgggaagtgaaacaccccctaccggttaacggtggcgtattggccacg
gcaggtggtctggtatttcagggaaccggtctgggaggctttcacgcctacgacgccgac
catggcaaacgtctctggagctttcaggccgatagtgcggtccttgctggccccattagt
tacagcctggatggcgagcaatatattgccgttgcccaaggctccggtggcagtatgatg
atggccatgggggtaaaattccctaatgccagcaaccccgccaagcctaaaaatccgaat
cgcctgctggtttttaaactacaagcgacagcagctgagcaacatagtaacaccactagc
caacgggctactccaccgaccatcgaagcccatacactcagtgaggaagaccttattgcc
ggagagacactatttgaaaataattgtggcttttgccacggcattagcgccgatgccagc
agcgtagtacccgaccttcgctatatgagcgaagagtcccaccagaatttccaggctatt
gtattggctggcctgcttacccataaagggatggtaggcttttatgccaacctaagcccc
gaagaggtggataaaatccacggctatttacgccagagaaaccatgacctgcatgatgaa
atcgccatggacaacctatgggataagctgcgctattggttttggtattacctgagcaaa
ctatcagacctattccccgccctcgccaatacagagtttgccaaagcaatggccaactaa

DBGET integrated database retrieval system