KEGG   Oceanicoccus sagamiensis: BST96_16235Help
Entry
BST96_16235       CDS       T04832                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
osg  Oceanicoccus sagamiensis
Pathway
osg00790  Folate biosynthesis
osg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BST96_16235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osg04147]
    BST96_16235
Enzymes [BR:osg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BST96_16235
Exosome [BR:osg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BST96_16235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ARN75519
UniProt: A0A1X9NJ57
Position
complement(3579032..3579328)
Genome map
AA seq 98 aa AA seqDB search
MSEIAALSDTEVQARLESHNEWALQGSKLYRRLVFEDFVHAFGFMTQIAIVAEKIDHHPE
WANVYRTVDIYLTTHEAGGVSERDFELLEKIEHLIGDR
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagattgccgcattaagtgataccgaagtacaagccagattggaatcacataac
gagtgggccttacagggcagtaaactctatcgtcgtctggtttttgaagactttgtacat
gcctttggctttatgacccaaatcgccatcgtggcagaaaaaatcgatcaccacccggag
tgggccaatgtctaccgcaccgtagatatttacctgaccacccatgaggcgggcggtgtc
agcgaaagggattttgaattactggaaaaaattgaacacctaatcggtgatcgttaa

DBGET integrated database retrieval system