KEGG   Oceanicoccus sagamiensis: BST96_18985Help
Entry
BST96_18985       CDS       T04832                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
osg  Oceanicoccus sagamiensis
Pathway
osg00071  Fatty acid degradation
osg00072  Synthesis and degradation of ketone bodies
osg00280  Valine, leucine and isoleucine degradation
osg00310  Lysine degradation
osg00362  Benzoate degradation
osg00380  Tryptophan metabolism
osg00620  Pyruvate metabolism
osg00630  Glyoxylate and dicarboxylate metabolism
osg00640  Propanoate metabolism
osg00650  Butanoate metabolism
osg00900  Terpenoid backbone biosynthesis
osg01100  Metabolic pathways
osg01110  Biosynthesis of secondary metabolites
osg01120  Microbial metabolism in diverse environments
osg01130  Biosynthesis of antibiotics
osg01200  Carbon metabolism
osg01212  Fatty acid metabolism
osg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:osg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BST96_18985
   00630 Glyoxylate and dicarboxylate metabolism
    BST96_18985
   00640 Propanoate metabolism
    BST96_18985
   00650 Butanoate metabolism
    BST96_18985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BST96_18985
   00072 Synthesis and degradation of ketone bodies
    BST96_18985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BST96_18985
   00310 Lysine degradation
    BST96_18985
   00380 Tryptophan metabolism
    BST96_18985
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BST96_18985
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BST96_18985
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BST96_18985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osg04147]
    BST96_18985
Enzymes [BR:osg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BST96_18985
Exosome [BR:osg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BST96_18985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARN75994
UniProt: A0A1X9NG31
Position
4182383..4183564
Genome map
AA seq 393 aa AA seqDB search
MSEDSVVIVSGARTPMGGLNGCMSAASAVDLATTAIGAAVERSGVAAEDIEQVVMGCVLQ
AGVKQGPARQAMIHAGIPKTTGAVTVNKLCGSGMQAAIYAHDMIKAGTATIALAGGMESM
TNAPHVLPASRNGIGTGDKTIYDHMFLDGLSDAYTGRAMGTFAQGTADDHNITREAMDAF
AIESTTRAQKAIADGSLKAEIVPVTIKTRKSETVIEDDEQPGKARLDKIPSLRPAFAKDG
TITPANSSSISDGASALVLMKESEAKARGLKPMARIVAHSSNSHEPELFTTAPIGSIEKV
LAKAGWAKDDVDLWEINEAFAMVTMLAIQGLELDHAKVNVHGGACAQGHPIGSTGSRIIV
TLMHAMQQYGKQKGVASLCIGGGEALSVALEAM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagattctgtagtcattgttagcggtgcccgtacacctatgggcggattaaac
ggttgcatgagtgctgcctccgctgttgatttagccaccacggccattggcgctgctgta
gagcgttccggcgtggccgcagaagatattgagcaagtggtgatgggttgcgtattacag
gcaggcgttaagcaaggccccgccagacaagccatgattcatgctggcatccctaaaacc
accggcgctgttaccgtgaataagctctgtggttccggtatgcaggcagctatttatgcc
cacgatatgattaaagcgggcaccgccactattgcactggcaggcggcatggagagcatg
accaatgctcctcacgtactacccgcttcccgcaacggtatcggcactggcgataaaacc
atttacgatcatatgtttctcgacggcttatctgatgcctataccggcagagcgatgggc
acctttgcccagggcaccgcagacgatcacaatattacccgtgaagcgatggatgccttt
gccattgagtccaccacccgcgcccaaaaagccattgccgacggttcattaaaagctgaa
attgtccctgtcacgattaaaacccgcaaaagcgaaaccgtgatcgaagatgatgagcag
cccggtaaagctcgcctggataaaatccccagcctgcgccctgcctttgctaaagacggc
acgattactcctgccaactccagctctatttctgacggcgcatcggcactggtactgatg
aaagaatctgaagccaaggctcgcggtttaaagcccatggcgcggattgttgctcactct
agtaactcccatgagccagagttatttactacggcaccgatcggttcgattgaaaaggtg
ttggccaaagcgggctgggctaaagacgatgtcgacctatgggaaattaacgaagccttt
gccatggtgacaatgttggccattcagggtctggaacttgatcacgccaaggttaatgtt
catggtggcgcctgtgctcaggggcaccccattggctcaactggctcacgcattattgtg
accctgatgcatgctatgcagcagtacggtaagcagaaaggtgtggcttctctatgtatt
ggtggtggcgaggctttatctgttgctcttgaagcgatgtaa

DBGET integrated database retrieval system