KEGG   Oceanicoccus sagamiensis: BST96_19165Help
Entry
BST96_19165       CDS       T04832                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
osg  Oceanicoccus sagamiensis
Brite
KEGG Orthology (KO) [BR:osg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osg03016]
    BST96_19165
Enzymes [BR:osg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BST96_19165
Transfer RNA biogenesis [BR:osg03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    BST96_19165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ARN76027
UniProt: A0A1X9NMK7
Position
4225019..4225786
Genome map
AA seq 255 aa AA seqDB search
MGYLRAPQAAATVNSLAIIYQDPYLVAINKPSGLLVHRSKIDRHETRFALQMLRDQLGQH
VFPVHRLDKPTSGVLLFALSSEIARQVSQAFANNQVSKSYLAIVRGWCAEQGTIDYALKE
QLDKMTDKLSRSDKPAQTAVTHFKRLATVELPFAVDKYPQSRYSLVEAKPITGRKHQLRR
HFKHIAHPIIGDAKHGKGSHNRFFQSQFDCHRLLLACTSLSIPHPISGEMVKLDAPLATD
FQSVIAQLGWSSPIN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggttacttaagagcccctcaggcagcagcaactgtgaatagcttagcgatcatttat
caggacccctatctagtggccatcaacaagcccagtgggctattggtacaccgcagtaaa
attgaccgccatgagactcgctttgccctgcagatgctgcgggaccagttggggcaacat
gttttccccgttcaccgcctggataaacctacatccggggtgttgttgtttgcactatcc
agcgaaattgcccgccaagtatcccaggcttttgccaacaaccaggtcagcaaaagctat
cttgccattgtcaggggctggtgtgcggagcaaggcacaattgattacgccttgaaagag
cagctggacaaaatgaccgataaacttagccgcagcgataagccagcccaaacggcagtc
acgcactttaagcgcttggccacagtggaattacccttcgccgtcgacaaatacccacaa
agccgctactccttggtggaggcaaaacccatcaccggtagaaagcaccagctgcgccga
cactttaagcatattgcccaccccattatcggtgatgccaaacacggcaaaggcagccac
aatcgcttttttcaaagccagtttgattgccaccgtttgttattagcctgcacatccctt
agcattccacacccaatcagtggggagatggtcaagcttgatgcaccactggctactgat
tttcaatcagtcattgcgcaactgggctggtcttcgcctataaactaa

DBGET integrated database retrieval system