KEGG   Oenococcus sicerae: DLJ48_04690Help
Entry
DLJ48_04690       CDS       T05833                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osi  Oenococcus sicerae
Pathway
osi00010  Glycolysis / Gluconeogenesis
osi00020  Citrate cycle (TCA cycle)
osi00620  Pyruvate metabolism
osi01100  Metabolic pathways
osi01110  Biosynthesis of secondary metabolites
osi01120  Microbial metabolism in diverse environments
osi01130  Biosynthesis of antibiotics
osi01200  Carbon metabolism
Module
osi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DLJ48_04690
   00020 Citrate cycle (TCA cycle)
    DLJ48_04690
   00620 Pyruvate metabolism
    DLJ48_04690
Enzymes [BR:osi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DLJ48_04690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: QAS69868
UniProt: A0A410N9J3
Position
920192..921493
Genome map
AA seq 433 aa AA seqDB search
MTEIFKMPDIGEGMAEGEISNWLVKVGDQVKTDDSVAEVQNDKLLQEILSPYSGKVTKLF
VDAGTTVEVGAPLIEFDGDGSGAAAESADTKKAAVSEPTAATKPATVDSQPAAAEKVTAA
GAATASNGNVLAMPSVRHFAFEKGIDLAAVPATGRHGHITMDDVKNFTAATTAAPVQEAA
ATAIETAKPAAKTNPVPEPLKEGRVPMTPVRRAIAKAMATQNATIPTVTNFDQIEVSKLV
AHRKQFKVLAADQNIHLTYLAYVAKALAATVKKFPELNASIDMDKQEIVYHDDINIGIAV
SAPTGLYVPVVVHADQKSIMTIASEIADLAASVRDGSIKGTQMQGATITITNIGSARGTW
FTPIINAKEVAILGLGSIVKEPIISDDGTIVVGQMMKLSLSYDHRLIDGMLGQTSVNYLK
SLLADPAYMLMEV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatctttaaaatgcctgatatcggcgaggggatggctgaaggcgaaatttct
aattggctggtcaaagtaggcgatcaagtgaagacagatgattctgtcgccgaagtgcag
aatgacaaactgctgcaagaaattttgtcgccctattcaggaaaagttacaaagcttttt
gttgatgcaggcacgactgttgaagttggcgcaccgttgattgaatttgatggtgacggt
agcggtgcagccgctgaatctgccgatacaaaaaaagcagctgtctccgaaccgaccgcg
gccactaaaccggcaactgtcgattcccagcccgcagctgctgaaaaagtcactgctgcc
ggcgcggcaacggcatcgaatggcaatgttttagccatgccatctgtgcgtcattttgcc
tttgaaaaaggcattgacctagcagctgtgccagctactggtcgtcatggccacatcacc
atggatgatgtcaaaaactttacagcagcaactacggctgctcctgtccaagaagcggct
gcgacagcgatcgaaacagctaaaccagctgctaagactaatcctgttcctgaaccgctc
aaagaaggacgtgtgccaatgacacctgtccgtcgagcgatcgcgaaagctatggccacg
cagaatgcgacgattccgacagtcacaaactttgatcagatagaagtatccaaactggta
gctcatagaaaacagttcaaggtacttgcggcagatcagaatattcatctgacttattta
gcttatgttgccaaagcgttggctgcgactgttaaaaagttcccagaactcaatgcatcg
atcgatatggacaaacaggaaattgtttaccatgacgatatcaatattggcattgctgtt
agtgcaccgaccggcctttatgtgcctgtcgtagttcatgctgatcaaaaatcaatcatg
acgatcgctagtgaaattgctgatttggctgcttctgtgcgtgatggttcgattaagggc
acacaaatgcagggtgcaacgattacgattacgaacattggttcagcacgcggtacgtgg
tttacgccgattattaatgctaaagaggttgccattttaggattgggttcgatcgttaaa
gaaccgattatttctgatgacggcacgatcgtggttggccaaatgatgaaattaagtttg
agttacgatcatcgtttgatagatggcatgcttggtcaaacttcagtcaactatttgaag
agcttgttggccgatccggcttatatgctgatggaggtgtaa

DBGET integrated database retrieval system