KEGG   Oenococcus sicerae: DLJ48_04800Help
Entry
DLJ48_04800       CDS       T05833                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
osi  Oenococcus sicerae
Pathway
osi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:osi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DLJ48_04800
Enzymes [BR:osi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DLJ48_04800
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DLJ48_04800
    1.1.1.-  
     DLJ48_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Sacchrp_dh_NADP AlaDh_PNT_C ADH_N_2 NAD_binding_2 ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: QAS69890
UniProt: A0A410N9Q2
Position
947439..948419
Genome map
AA seq 326 aa AA seqDB search
MLRKSIYWPKAKDVEYHEEDTGQPKDNDILIENHYSLVSQSSEREWLENDRSHVVLGTTF
PFIPGYSSVGYVKAIGASVSGFEVGDKVIGAPVYGAHSNLTYVKQQDVYHVPENVHLDDA
VFYNLGMTAIYTLQNSGLKLGHSIALIGQGVVGQIATQVAKASGFHPIVTFDLEENRRQR
ALENGADYALDPSDAAAIEDLIKKLAGGVDAAIDMSGSNAGMNLAIHLTKTLGTTVFCTG
NNDPQLLNYGEIFIKCLTVKGDFVNTQMALQRKCINTFLWLLSTGTIQVPDHENTIYEPT
EANIKKIYGRVLAKDRTLNNPIFKWN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctacgaaaatctatttattggccaaaagccaaagacgttgaatatcatgaagaggat
acgggtcagccgaaagacaatgacattctgattgaaaatcattactctttggttagtcaa
agcagtgaaagggagtggcttgaaaacgatcgttctcatgtggtcctgggtacgacattt
ccatttattccaggatatagttcagttggatatgtaaaagcaattggtgccagcgttagc
ggatttgaagttggtgataaggtcatcggcgctcctgtttatggtgcacactctaatctg
acatatgttaaacagcaagatgtttaccatgttcctgaaaatgtgcacttagatgatgcg
gttttttacaatcttggaatgacggcgatttatacgctgcaaaattcgggactgaaatta
ggacattcaattgcattgatcggtcaaggagtggttggacaaatcgcgacccaagtagcg
aaagcaagtggatttcatccgatcgtgacatttgatcttgaggaaaaccgtcgtcagagg
gctttagaaaacggtgccgattatgcgctagatccatcagatgcagctgctatcgaggat
cttattaaaaaactagccggtggtgttgatgctgcgattgatatgtctggcagcaacgct
ggtatgaatttagcgattcacttgaccaaaactttgggaacgaccgtcttttgcactggc
aataacgatccgcaattattaaattatggcgaaatatttattaaatgtttgacggtcaaa
ggtgactttgtgaatacgcagatggctttgcagcgtaaatgtattaatacctttttgtgg
cttctgagtactggcactatccaagttcctgatcatgaaaatacgatttacgaaccaaca
gaagcgaatatcaaaaaaatttatggacgcgtccttgctaaagaccggacattaaataac
cccatttttaaatggaactaa

DBGET integrated database retrieval system