KEGG   Odoribacter splanchnicus: Odosp_0254Help
Entry
Odosp_0254        CDS       T01428                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00010  Glycolysis / Gluconeogenesis
osp00052  Galactose metabolism
osp00500  Starch and sucrose metabolism
osp00520  Amino sugar and nucleotide sugar metabolism
osp00521  Streptomycin biosynthesis
osp01100  Metabolic pathways
osp01110  Biosynthesis of secondary metabolites
osp01120  Microbial metabolism in diverse environments
osp01130  Biosynthesis of antibiotics
osp01200  Carbon metabolism
Module
osp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_0254
   00052 Galactose metabolism
    Odosp_0254
   00500 Starch and sucrose metabolism
    Odosp_0254
   00520 Amino sugar and nucleotide sugar metabolism
    Odosp_0254
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Odosp_0254
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Odosp_0254
Enzymes [BR:osp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Odosp_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase DUF4651 Terpene_synth
Motif
Other DBs
NCBI-ProteinID: ADY31357
UniProt: F9Z453
Position
294294..295190
Genome map
AA seq 298 aa AA seqDB search
MEDIYVLGVDIGGSHIACQLVNLSDCSLIENTYAEVKVAENQSAGIILAAWEKALKECMG
KAAGKIIRGIGVAMPSPFDFVQGIAMADHKFASLKGLNIRQELSRVTGILPSSILFTNDA
AAFGMGAWRLNGSRDRHLIGVTLGTGFGACFIVDGCYATYGPGVPIGGELWNYPFRGVIA
EDYVSTRWFEKRFAELTGEAIHGVKGMIDLYQAGKYKTETEQVFREFSNSFGEIMVPFMT
RFNADMLVIGGGMVLSEQYFLPLIGQYMKANGINASIMTVADTTTAIIAGAAALCDLI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggaagatatttatgtgctgggtgtggatatcggagggtcacacattgcttgtcagctt
gttaatttgagcgactgtagtttgatcgaaaatacgtatgccgaagttaaagtggctgaa
aatcaaagtgccggtattattctggcagcttgggaaaaagcgttgaaagagtgtatgggt
aaagcggcaggtaagattatccgtggaattggagtcgctatgccatcacctttcgatttt
gtgcaggggatcgctatggccgatcacaaattcgcttctctgaaaggactgaatatccgt
caggagttgagccgtgttacaggcatcctgccttcttctattttatttacgaacgatgcc
gctgctttcggtatgggcgcctggagattgaacggaagccgtgaccgccatttgatcgga
gtgactttgggtaccggtttcggagcttgttttatcgtagacggttgttatgctacttat
ggccccggagtgcctatcggaggagaactgtggaattatccgttccgtggggtgatcgct
gaggattatgtttctacccgctggttcgaaaagcgttttgccgaattgaccggagaggcg
attcacggggtgaaaggaatgatcgatttataccaggccggtaaatataagacagagacc
gagcaggtcttccgtgaattttcgaattctttcggagagatcatggtgccctttatgacc
cgatttaatgccgatatgctggtgatcggaggaggtatggtactttccgaacagtatttc
ctgcctttgatcggtcaatatatgaaagccaacgggatcaatgcttctatcatgacggtc
gccgatacaacgactgcaattattgcgggagctgctgctttatgtgatttgatataa

DBGET integrated database retrieval system