KEGG   Odoribacter splanchnicus: Odosp_0740Help
Entry
Odosp_0740        CDS       T01428                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00780  Biotin metabolism
osp01100  Metabolic pathways
Module
osp_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:osp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Odosp_0740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osp01007]
    Odosp_0740
Enzymes [BR:osp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Odosp_0740
Amino acid related enzymes [BR:osp01007]
 Aminotransferase (transaminase)
  Class II
   Odosp_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase DRMBL
Motif
Other DBs
NCBI-ProteinID: ADY31818
UniProt: F9Z7W4
Position
complement(876549..877712)
Genome map
AA seq 387 aa AA seqDB search
MNKERYYHKLETIKESGNYRILREIEHNGFLIHDDGREMLNLSSNDYLGLSSNPRLIEEF
REETDVMALPYSAVSSRLLSGNHPYYKMLEDDLADLYDKEAALVFNSGYHANIGILPALT
NKRDLIVADKLVHASIIDGLRLSEAQMIRYKHLDYEHLRSILTRHREEYDNVFIVTESIF
SMDGDTSDLQQLCEIKKEFDAFLYVDEAHAVGVRGTNGLGCCEEQACMEDIDFIVGTFGK
AFASMGAFVVCEQVFRDYLINTQRSLIFTTALPPVNVAWTRFILNRMPDFYDLRIKLAEI
ASKLRQVLVEKGFETRGDSHIVPMVCGSNESSVEMSELLRDNGFFVLPVRYPTVPKNEAR
IRFSLNASIPTEDYGCLFEFLECLVCE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagagcgttattatcacaaattagaaaccataaaagaatccggtaattaccgg
atcctgagggaaatcgaacacaacggttttctgatccacgacgacggacgtgagatgctg
aatctgtcttcgaacgattatctgggcttatcgtctaatccacgcctgattgaagaattc
cgtgaagagacagatgttatggctttaccatacagtgctgtatcttccagattattatcc
ggaaatcatccttattacaaaatgctcgaggacgatttagccgatctttacgataaagag
gcagccttggtattcaattcgggttatcatgccaatatcggaattttgcctgctttaacc
aataagcgggatctgatcgttgcagataaattggtgcatgccagtattatcgacggattg
cggttgagtgaggctcagatgatcagatacaaacatttggattacgaacatttgcgaagt
atactgacccggcaccgggaggaatatgataatgtattcatcgttacggagtctattttt
agtatggatggagatacgtcggatttacaacaattgtgtgaaataaagaaggaattcgac
gcctttttgtatgtagacgaggcacatgccgtaggagtaagggggacgaatgggttaggt
tgttgtgaagaacaagcttgtatggaagatatcgattttatcgtcggtacttttggaaaa
gcttttgcttcgatgggagcttttgtcgtgtgtgaacaagtatttcgcgattatttgatc
aatacgcaaagaagcctgatttttacaacggctttgcctcctgtaaatgtggcgtggacg
cggtttattctcaaccggatgcccgatttttacgatcttcggatcaaattggccgaaatt
gcttcgaagttacggcaggtattggtcgaaaaaggattcgaaacccggggcgactctcat
atcgtacctatggtatgtggttctaatgagagtagtgtagaaatgtcggaattacttcgg
gataacggattttttgttttgccggtgcggtatccgaccgtacccaaaaatgaagcccgt
atccgtttctccctgaatgcttctattccaaccgaagattatggttgtttatttgaattt
ttggagtgtctggtatgcgaatag

DBGET integrated database retrieval system