KEGG   Odoribacter splanchnicus: Odosp_0959Help
Entry
Odosp_0959        CDS       T01428                                 

Definition
(GenBank) transferase hexapeptide repeat containing protein
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00520  Amino sugar and nucleotide sugar metabolism
osp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Odosp_0959
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:osp01005]
    Odosp_0959
Enzymes [BR:osp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     Odosp_0959
Lipopolysaccharide biosynthesis proteins [BR:osp01005]
 Unusual sugar
  Odosp_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: ADY32030
UniProt: F9Z9N0
Position
complement(1137031..1137606)
Genome map
AA seq 191 aa AA seqDB search
MKQKYFAHETAVIDENCQIGEGTKIWHFSHIMTGCVIGTNCNIGQNVVISPEVVLGNNVK
VQNNVSVYTGVTCEDDVFLGPSCVFTNVTNPRSAVNRKSQYARTHVGKGATIGANATVVC
GHDIGAYAFIGAGAVVTKHVPDYALLVGNPARQLGWMSEYGHRLYFDAEGIAECPESHEK
YQLKDGKVFKL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaatattttgctcatgaaacggctgttatagacgaaaattgtcagattggg
gaaggaacgaaaatctggcatttcagtcatattatgacagggtgtgtgatcgggacgaac
tgcaatatcggtcagaatgtagtgatctctccggaggtcgtcttgggaaacaatgtaaaa
gtgcagaataatgtatcggtttataccggagtaacttgtgaagacgatgttttcctgggg
ccttcctgtgtatttactaacgttaccaatccccggagtgccgtcaaccggaaatcccag
tatgccaggactcatgtagggaaaggggcgacaatcggtgcaaatgctaccgttgtttgc
ggacacgatatcggtgcctatgcttttatcggtgccggagctgtcgtgacgaaacatgta
cccgattatgccctgttggtaggtaatcctgcccgtcagctgggctggatgagcgagtat
ggacaccggctttattttgatgctgaagggattgccgaatgcccggaaagccacgaaaag
taccagttgaaggacgggaaagtatttaaattgtag

DBGET integrated database retrieval system