KEGG   Odoribacter splanchnicus: Odosp_1121Help
Entry
Odosp_1121        CDS       T01428                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00010  Glycolysis / Gluconeogenesis
osp00051  Fructose and mannose metabolism
osp00562  Inositol phosphate metabolism
osp01100  Metabolic pathways
osp01110  Biosynthesis of secondary metabolites
osp01120  Microbial metabolism in diverse environments
osp01130  Biosynthesis of antibiotics
osp01200  Carbon metabolism
osp01230  Biosynthesis of amino acids
Module
osp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osp_M00002  Glycolysis, core module involving three-carbon compounds
osp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_1121
   00051 Fructose and mannose metabolism
    Odosp_1121
   00562 Inositol phosphate metabolism
    Odosp_1121
Enzymes [BR:osp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Odosp_1121
Exosome [BR:osp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Odosp_1121
  Exosomal proteins of bladder cancer cells
   Odosp_1121
  Exosomal proteins of melanoma cells
   Odosp_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF1611 Succ_DH_flav_C Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ADY32186
UniProt: F9ZAT7
Position
1333443..1334210
Genome map
AA seq 255 aa AA seqDB search
MRKKIVAGNWKMNKTLQEGIELAKEVNSKVKAANAKDVKVIIGTPFIHLAEVSKMVDPAV
IAVSAQNCATEVSGAYTGEVSAAMVASTGSRYVILGHSERRSYYGETDEILVKKVQRALE
NNLDVIFCVGEVLAEREAGKHFEVVKSQLVNGLFNLSADQFAHIVVAYEPVWAIGTGKTA
TSAQAEEMHAFIRKTIADKYGKEVADNTSILYGGSCNPKNADELFCQADVDGGLIGGASL
KADDFMAIITARQKH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaattgttgccggtaactggaaaatgaacaaaaccctgcaggaagggatt
gaactggctaaagaggtaaacagcaaagtaaaagctgctaatgcaaaggatgtgaaggtc
atcatcggtacccctttcattcatctggccgaagtaagtaaaatggtagatcctgcagtc
attgccgtatctgcacaaaactgcgctacagaagtctccggagcatataccggtgaagta
tccgcagctatggtggcctctaccggaagccggtatgtcattctcggtcactctgaaaga
agaagctattacggagaaaccgatgaaatcctggttaagaaggtacaacgtgccctggaa
aataacctggatgtcattttctgcgtcggagaagttttagccgagagggaagccggcaaa
catttcgaagtagtaaaatctcaattggtaaacggtttattcaacctctctgccgatcag
ttcgcacacatcgtcgtagcttacgaaccggtatgggctatcggtaccggcaaaacagcc
acctctgcacaagctgaggaaatgcatgcctttatccgtaaaaccatcgccgacaaatat
ggtaaagaagtagctgacaacacctcgatcttatacggcggaagctgcaaccccaaaaat
gccgacgaactattctgtcaggcagacgtcgacggtggccttatcggcggagcttccctg
aaagccgacgactttatggctatcattacggcacggcagaagcattaa

DBGET integrated database retrieval system