KEGG   Odoribacter splanchnicus: Odosp_1900Help
Entry
Odosp_1900        CDS       T01428                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00010  Glycolysis / Gluconeogenesis
osp00020  Citrate cycle (TCA cycle)
osp00620  Pyruvate metabolism
osp01100  Metabolic pathways
osp01110  Biosynthesis of secondary metabolites
osp01120  Microbial metabolism in diverse environments
osp01130  Biosynthesis of antibiotics
osp01200  Carbon metabolism
Module
osp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Odosp_1900
   00020 Citrate cycle (TCA cycle)
    Odosp_1900
   00620 Pyruvate metabolism
    Odosp_1900
Enzymes [BR:osp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Odosp_1900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ADY32908
UniProt: F9Z7I3
Position
2268201..2269808
Genome map
AA seq 535 aa AA seqDB search
MSKLDLSKYGITDVKEILHNPSYEELFKAETDPSLTGYEKGQVTELGAVNVMTGIYTGRS
PKDKFFVKNEASEKTVWWTSEEYKNDNKPCSEEAWADLKAKAVKELSGKKLYVVDTFCGA
NAGTRLKVRFIMEVAWQAHFVKNMFIRPTEEELANYGEPDFVSFNAAKAKVDNYKELGLN
SETATVFNLRTNEQVILNTWYGGEMKKGIFSIMNYLNPLRGIASMHCSANTDLEGKNTAI
FFGLSGTGKTTLSTDPKRLLIGDDEHGWDDEGVFNYEGGCYAKVINLDKDSEPDIYNAIK
RDALLENVTVDANGKIDFNDKSVTENTRVSYPIYHIKNIVKPVSKGPAAKQVIFLSADAF
GVLPPVSILNAEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTKYAEEL
VKKMEKSGAKAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIDKAPTKTIPFFDFVVPTA
LPGVDPKILDPRDTYANASEWETKAKDLSERFIKNFKKFEGNAAGKALVAAGPKL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattagatttaagcaagtatggcattaccgatgtgaaagaaatccttcacaat
ccttcttacgaggaattattcaaagccgaaaccgatccctctttaaccgggtatgaaaaa
ggccaggtaaccgaattaggtgctgtaaacgtaatgacaggtatttataccggtcgttct
cctaaagataaattctttgtaaaaaatgaagccagtgaaaaaactgtttggtggacttca
gaagaatacaaaaacgacaacaaaccttgtagcgaagaagcttgggccgatctgaaagca
aaagctgttaaagaattatcaggtaaaaaattatacgttgtcgatactttctgcggagca
aacgcaggtactcgtttgaaagttcgtttcatcatggaagttgcgtggcaggctcatttc
gtaaagaatatgtttatccgtcctaccgaggaagaattggccaactacggcgaaccggat
ttcgtttctttcaatgctgctaaagctaaagtagacaactacaaagaactgggtctgaat
tcagaaacagcaactgtattcaacctaagaaccaatgagcaggtgatactgaatacctgg
tacggcggagaaatgaaaaaaggtattttctctatcatgaattacctgaatccgttacgt
ggtatcgcttctatgcactgctcggcaaacaccgatctggaaggtaaaaacacagctatt
ttcttcggtctgtccggaaccggtaaaaccactttatcgaccgacccgaaacgtttgttg
atcggggatgacgaacacggttgggatgacgaaggtgtgttcaactacgaaggcggttgc
tatgcaaaagtaatcaatctggacaaagacagcgaaccggatatctacaacgccatcaaa
cgtgacgccctgttggagaacgtaactgtagatgcaaacggcaagatcgatttcaacgac
aaatcggtaactgaaaacacccgtgtttcttatccgatctatcacatcaagaatatcgtc
aaaccggtatctaaaggcccggcagccaaacaggttatcttcttgtcagccgacgcattc
ggagtattgcctccggtatccatcctgaacgcagaacagacaaaatattatttcctgtcc
ggatttaccgcaaaattggcaggaacagagcgtggaattaccgagccgacaccgactttc
tctgcttgtttcggagctgctttcttatcactgcatcccaccaaatatgcagaagagctg
gtaaagaaaatggaaaaatcaggtgctaaagcttatttagtaaacaccggatggaacggt
accggcaaacgtatttctattaaagatacccgtggtatcatcgatgccatcctggacggt
tctatcgataaagctccgaccaaaacgatcccgttctttgatttcgttgttccgaccgct
ctgccgggcgtagatccgaaaatcctcgatccccgcgatacttatgctaacgcaagcgaa
tgggaaaccaaagcaaaagatctttcagaacggttcatcaaaaacttcaagaaatttgag
ggtaatgctgccggtaaagctctggttgctgcaggaccgaaactttaa

DBGET integrated database retrieval system