KEGG   Odoribacter splanchnicus: Odosp_1952Help
Entry
Odosp_1952        CDS       T01428                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00250  Alanine, aspartate and glutamate metabolism
osp00330  Arginine and proline metabolism
osp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Odosp_1952
   00330 Arginine and proline metabolism
    Odosp_1952
Enzymes [BR:osp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Odosp_1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADY32959
UniProt: F9Z823
Position
2333895..2335526
Genome map
AA seq 543 aa AA seqDB search
MPKGVYKLPNITNEPIKSYAPGSPERAALKEKLNEIHNQVVDIPMIIGGKEIRTDKLADI
RPPHDHQHLLGHYHQGDASHVQLAIDAAMKAKPAWEKMNWESRAAIFLKAAELIAGPYRQ
ILNAVTMLGQSKNAFQAEIDCVCELADFYRFNVKNMYDLYHMQPNSSAGIWDRTVWRPLE
GFVFALTPFNFTSIAGNLPGAPALMGNVCVWKPSKTAVYSAYIVMKILQEAGLPDGVINL
VYCSGPTASDVIFSNKDFAGIHFTGSTGVFNDIWATIVKNIGKYRSYPRIVGETGGKDYV
FADPTAKALPVATALIRGAFEYQGQKCSAASRAYIPSNIWPEVKALMQADLNKIKTGGVE
DFSNFVNAVIDEASFDKLAKAIDDAQASPDAEVILGGKYDKSKGYFIYPTVIQAKKPDYI
TMREELFGPVLTIYVYEPDQIEETLDLLDAGSAYALTGAIFSNDRANIEKLTERLTHTAG
NFYINDKPTGAVVDQQPFGGGRASGTNDKAGSVFNLLRWVSPQCIKETFIPATNYMYPNF
LES
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaggagtttacaaattaccaaacattaccaatgaaccgataaaaagttatgct
ccgggatctcccgaacgcgcagcattaaaagaaaaattaaacgagatccataatcaggta
gtcgacatcccgatgatcatcggtggcaaagaaatccggaccgataaactggccgacatt
cgtccgcctcatgatcaccagcatttattagggcattatcaccaaggagatgcctcccat
gtacaattagctatcgacgctgcaatgaaagcaaaaccggcttgggaaaagatgaactgg
gaaagccgggctgctatttttctgaaagcggcagagctgattgccggtccttaccgtcag
attttaaatgccgtgacgatgttgggacaatccaagaatgcttttcaggcagagatcgac
tgtgtttgtgaattggctgatttctatcgtttcaatgttaaaaatatgtacgatctttat
catatgcaacccaactcgtcggcaggcatctgggatcgtacggtatggcgcccgttagaa
ggtttcgtatttgccctgactccgttcaatttcacttctattgccggtaatttgccggga
gctcctgctttaatgggaaatgtttgtgtatggaaaccttcgaaaactgcagtctattca
gcttatatcgtcatgaaaatattacaggaagccggtctgcccgacggtgtgatcaacttg
gtatactgttcaggcccgacagcttcagacgtaatattcagcaataaggactttgccggt
attcatttcaccggttctaccggagtattcaatgacatctgggctactatcgttaaaaac
atcggtaaatatcgttcttatccacgtatcgtcggtgaaaccggaggtaaagattatgtt
tttgccgacccgacagctaaagcactaccggtagcgacagctttaatccggggagccttt
gaatatcagggacaaaaatgttctgccgcttcacgcgcttacattccttccaacatctgg
ccggaagtaaaagctttgatgcaggcagatttgaataaaatcaaaaccggaggagtcgaa
gatttcagtaacttcgtcaatgctgtgatagatgaagcttctttcgacaaactggccaaa
gcaatcgatgatgcgcaagcttcgcccgatgccgaagtgatcctgggaggcaaatacgat
aaatccaaaggctactttatttacccgactgttatccaagccaagaaaccggactatatt
acgatgcgcgaagaattgttcggtccggtattgacgatctacgtatacgaacccgatcaa
atagaggaaacgctcgacctgctggatgccggttcagcttatgccttgaccggagctatt
ttctccaacgacagagctaacatcgaaaaattgaccgaacgcctgacacatacagccggc
aatttctacatcaacgacaaacctaccggagctgtcgtcgaccagcaacctttcggcggc
ggccgggcttccggaaccaacgataaagccggatccgtgttcaacctgctgagatgggta
tctccacaatgtatcaaagaaaccttcatccccgcaaccaactacatgtatccgaatttt
ttggaaagctaa

DBGET integrated database retrieval system