KEGG   Odoribacter splanchnicus: Odosp_2451Help
Entry
Odosp_2451        CDS       T01428                                 

Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
osp  Odoribacter splanchnicus
Pathway
osp00860  Porphyrin and chlorophyll metabolism
osp01100  Metabolic pathways
Module
osp_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:osp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Odosp_2451
Enzymes [BR:osp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Odosp_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase
Motif
Other DBs
NCBI-ProteinID: ADY33440
UniProt: F9ZBR4
Position
complement(2935276..2936769)
Genome map
AA seq 497 aa AA seqDB search
MEKIEKKKLRPIMFVGTCSDAGKSILNTAFCRIFRQDGYRPAPFKAQNMSLNSCSTPEGG
EIGRAQAVQAEACGILPHTDMNPVLLKPSTDQTSQVILNGKAVGNMSAREYFRSGNKTQL
FTEAVKAFHRLEENHNPIVLEGAGSISELNLRDRDITNMRMAKEVDAATYLVADIDRGGV
FASVYGSVMLLPEEERCLIKGVIINKFRGDVSLFEEGRQIIRELTGVPVVGVIPYYKDIH
IEEEDSVALEAKASAAVAGKINVAVIRLPRMSNFTDFNALERDGRFHLYYTDKAEEIGKA
DVIILPGTKSTIADLQAIYANGVAEAVVKAFRKKKKVIGICGGYQMMGVRIEDPGQVEGM
QTATDGLGLLPLVTVMQDAKVVCQSHFRFKNYESDCAGYQIHMGTTTPLHAGGRQTTLNT
LADGTTDGYRLNADCWGSYMHGILDNPVVLDDLAAGFGVAAGSGFDYRAFKERQYDLLAG
QVRKAVDLDYIYSTLFL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatagagaaaaaaaaactacgtccgattatgtttgtcgggacttgttcggat
gcgggaaaaagtatcctgaatacggctttttgccgtattttcagacaagacggctatcgg
ccggcgccttttaaagcgcagaatatgtcgttgaattcctgttctacgccggagggagga
gaaatcggaagagctcaggccgtgcaggcggaggcatgtgggatcttgccgcatacggat
atgaatccggttttgttgaagccgtccaccgatcagacttcccaggtgatattgaacggc
aaggctgtggggaatatgtccgcccgggaatattttcgttcggggaacaaaacgcaatta
tttaccgaggccgtgaaggcatttcatcgtctggaggaaaaccataatcctatcgtattg
gagggggccggtagtatctccgagcttaatttacgggacagggatatcacgaatatgcgg
atggcaaaagaggtggatgctgcgacttacctggtggcggatatcgatcggggaggagtg
tttgcttctgtttatggttccgtgatgttgctgcctgaagaggagagatgcctgatcaaa
ggtgtcattatcaataaatttcgcggcgatgtgtcacttttcgaggaaggacggcagatc
atccgggagcttaccggagtgccggtggtcggtgtaatcccttattataaagatattcat
atcgaagaagaagattctgtcgctttggaggcaaaagcttctgctgctgtggcagggaag
atcaatgtggcggtgattcgtctgccgagaatgtctaatttcaccgatttcaatgcattg
gagagagacgggcgtttccatttatattatacggataaagcggaggagatcggtaaagcg
gatgttatcattctgccgggaacaaaaagtaccatagccgatttgcaggctatttatgcc
aacggggtggccgaagctgtggtgaaggcgtttcggaagaagaaaaaagtcatcggcatt
tgtggcgggtatcagatgatgggagtgcggatcgaggatcccgggcaggtcgaaggtatg
caaaccgcgaccgacggattgggtttactgcctctggtcacggtgatgcaggatgcgaag
gtggtttgtcagagtcatttccgttttaagaattatgaatcggattgtgccggttatcag
attcacatggggacgacgacacctttacacgcgggagggcggcaaacaacgctcaatacc
cttgcggacggtacaaccgacggttatcggttgaacgcagactgctggggaagttatatg
cacggtatcctcgacaatccggttgttttagacgatctggccgcaggtttcggagtggct
gccggcagtggttttgattacagggcttttaaagaacggcaatacgaccttctggccggt
caggtacggaaagctgtcgatttggactatatttattcaactttatttttataa

DBGET integrated database retrieval system