KEGG   Ostreococcus tauri: OT_ostta03g05880Help
Entry
OT_ostta03g05880  CDS       T01358                                 

Definition
(RefSeq) Ribosomal protein L22,bacterial/chloroplast-type
  KO
K02890  large subunit ribosomal protein L22
Organism
ota  Ostreococcus tauri
Pathway
ota03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ota00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    OT_ostta03g05880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ota03011]
    OT_ostta03g05880
Ribosome [BR:ota03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    OT_ostta03g05880
  Bacteria
    OT_ostta03g05880
  Archaea
    OT_ostta03g05880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 9833684
NCBI-ProteinID: XP_003078508
Position
3
AA seq 260 aa AA seqDB search
MSSAFASAVRRAFHRSDVTTASSVALRAFASSVFERRALAPSLARSAAVSTSRRAHASST
ASTANAGERASDSQTTPTSSTSEPGMSPLRRAPPPARATRGAVIPGALTDGGISERARAV
LRDAKGSPKKFSAFLRLIRGLRVDDALIQCDMSPKRVAKTVGKVIQSAVGNAVNNQGLDR
DRLVIAWATVGKGQYLRRVSMHGRGRAGVMHRPRTHVAIAVEENDDVERRVQIFDDEMPW
QRRRRLGRAKQAIAEAAGIA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgcgttcgcgagcgcggtgcgacgggcgtttcatcgctcggacgtcaccacc
gcgtcctccgtcgccctgcgcgcgttcgcgtcgtccgtgttcgagcgacgggcgctcgca
ccgtcactcgcgcgaagtgccgcggtctcgacctcgcgacgcgcgcacgcgtcgtccacg
gcgtcgacggcgaacgcgggcgaacgcgcgagtgactcgcagacgacgccgacgtcgtcg
acgagcgaaccggggatgagtccgctgcgtcgggcgccgccgccggcgcgcgcgacgcgc
ggcgcggtcattccgggcgcgctcacggatggtggaatttctgaacgcgcgcgcgctgtt
ttacgcgacgccaagggatcgccgaagaagttcagcgctttccttcgtctcattcgcgga
ctgcgcgtggacgacgcgctgatacagtgcgacatgtctccgaagagagtggcgaagacg
gtggggaaagtgattcagtcagccgtggggaacgcggtgaacaatcagggtctcgatcgc
gatcggctcgtcatcgcctgggccaccgtggggaaagggcaatatctgcggagggtctcc
atgcacggtcgtgggcgcgcaggggtgatgcatcgaccgcgcacgcacgtggcgatagct
gtggaggaaaacgatgacgtcgagcgacgcgtacagatttttgacgacgagatgccttgg
cagcgaaggcgtagactgggacgggcgaaacaggcgatcgcggaggccgcgggtatcgcg
tga

DBGET integrated database retrieval system