KEGG   Ostreococcus tauri: OT_ostta03g05920Help
Entry
OT_ostta03g05920  CDS       T01358                                 

Definition
(RefSeq) Succinyl-CoA synthetase-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ota  Ostreococcus tauri
Pathway
ota00020  Citrate cycle (TCA cycle)
ota00640  Propanoate metabolism
ota01100  Metabolic pathways
ota01110  Biosynthesis of secondary metabolites
ota01200  Carbon metabolism
Module
ota_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ota00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OT_ostta03g05920
   00640 Propanoate metabolism
    OT_ostta03g05920
Enzymes [BR:ota01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     OT_ostta03g05920
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OT_ostta03g05920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 9832978
NCBI-ProteinID: XP_003078495
UniProt: Q01BS2 A0A454XXV3
Position
3
AA seq 331 aa AA seqDB search
MRVLALARRARESQRGVANALTRSSIARTADYSTAPAVFVDGNTRVIVQGFTGKNGTFHS
EQAIAYGTKVVGGVTPKKGGTTHLGLPVFDTVREAVVETKANASVIYVPPPFAAKAIMEA
VEAEIDLVVCITEGVPQHDMVRVKRALMSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHK
PGRIGVVSRSGTLTYEAVYQTTVTGLGQSTCVGIGGDPFNGTNFVDCLEKFVKDPQTEGI
IMIGEIGGTAEEEAAEFIRASGTDKPIVSFIAGLTAPPGRRMGHAGAIISGGKGGASDKI
AALEAAGVRVVKSPAKMGQAMYDMFAERKML
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctcgccctcgcgcgtcgcgcgcgcgagagccaacggggcgtcgcgaacgcg
ctgacgcgatcgtccatcgctcggacggcggattattccaccgcgcccgcggttttcgtc
gatggaaacacgcgcgtgatcgtgcagggattcactggaaagaacggaacgttccacagc
gaacaggcgatcgcgtacgggaccaaggtcgtgggaggcgtgacgccgaagaagggcggg
acgacccacctcgggctgccggtgttcgacaccgtgcgagaggcggtggtggagacgaag
gcgaacgcgtcggtgatttacgtcccaccgccgttcgcggcgaaggcgatcatggaggcc
gtcgaggccgagatcgatctcgtcgtgtgcatcacggagggcgtaccgcaacacgacatg
gtgcgcgtgaagcgcgcgctcatgagtcaaagtaagacgagactcatcggaccgaactgc
ccagggatcatcaagcccggagagtgcaagatcggcatcatgccagggtacattcacaag
ccgggacgcatcggcgtcgtctcgcgttcggggacgttgacgtacgaggctgtttatcag
acaactgtaaccggcttggggcagtcgacgtgcgtcggcatcggcggagatcctttcaac
ggcaccaactttgtagattgtctcgaaaagttcgtcaaagatccacaaaccgaaggaatc
atcatgatcggtgagattggaggtaccgccgaggaagaggctgcggaatttatcagagcg
agcggaaccgataagcccatcgtctcgttcatcgccggcttgaccgctccgcctggaaga
cgcatgggacacgctggggccatcatctccggcggcaagggcggcgcgagcgataaaatc
gccgccctcgaggctgcgggcgtgcgcgtcgtaaagtctccggcgaagatgggtcaggca
atgtatgacatgtttgccgagcggaaaatgctgtag

DBGET integrated database retrieval system