KEGG   Ostreococcus tauri: OT_ostta06g00520Help
Entry
OT_ostta06g00520  CDS       T01358                                 

Definition
(RefSeq) P-loop containing nucleoside triphosphate hydrolase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ota  Ostreococcus tauri
Pathway
ota00230  Purine metabolism
ota00250  Alanine, aspartate and glutamate metabolism
ota01100  Metabolic pathways
Module
ota_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ota00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    OT_ostta06g00520
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OT_ostta06g00520
Enzymes [BR:ota01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     OT_ostta06g00520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt CCDC92
Motif
Other DBs
NCBI-GeneID: 9835521
NCBI-ProteinID: XP_022839144
Position
6
AA seq 480 aa AA seqDB search
MATARVMVADRARAFGGTTATRARRDDQGRRVTIARGIPSRARVVVARASERAYAELGNV
CAVLGSQWGDEGKGKLVDILAREYDVVARCQGGANAGHTIYDDNGKKYALHLVPSGILNE
NATCVVGNGVVVHLPGMFEEIDKLLQAGVDARGRMIVSDRAHLLFDLHKEIDGLREEELS
GNKIGTTKRGIGPAYASKATRNGVRLGDIRDEERFATMLRALAADAAARFEGFQYDVEAE
IVRYKEIAERIEPFIADTVEYINEAHDSGKKILVEGANATMLDLDFGTYPFVTSSNPALG
GVCNGLGLAPRKFKTIIGVAKAYTTRVGAGPYPTELFGDVADKLRELGYEYGTTTGRPRR
IGWLDMVALNYANLINGFTHLNITKLDVLSEMDELKIGVAYKLPNGKTTKSFPADIATLE
KVETVYETLPGWKEDISKVRTWDDLPENAKKYVLRVEELAGVECKFIGVGPGRDAMVIKP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcgcgcgtgatggtcgccgaccgcgcgcgcgcgttcggggggaccacggcg
acgcgcgcgcgaagggacgaccaggggcgacgggtgacgattgcgagggggatcccatcg
cgcgcgcgcgtcgtcgtcgcgcgcgcgtcggagcgggcgtacgcggagctcgggaacgtg
tgtgcggtgctcggaagccagtggggcgacgagggcaaggggaagttggtggatattttg
gcgcgggagtacgacgtcgtggctcgatgccagggcggggcgaacgccgggcacactatt
tacgatgataatgggaagaagtacgccctgcatctcgttccgagcgggattttgaatgag
aacgccacgtgcgtcgtcgggaacggcgtcgtggtgcacctgccggggatgttcgaagag
attgataaactcttgcaggcgggtgtggacgctcgcgggcgcatgatcgtgtccgatcgc
gcgcacttgttgttcgacctacacaaggagatcgatggcctgcgcgaggaggagttgagt
gggaacaaaatcggcacgacgaagcgcggcatcggcccagcgtacgcgagcaaggcgacg
cgcaacggtgttcgattgggggacattcgcgatgaagagagattcgcgacgatgctcaga
gcgctcgcagccgacgccgcggcgcggttcgaagggtttcagtacgacgtcgaggcggag
attgtgcggtacaaggaaatcgccgagcgcattgaacccttcattgcggacacagtggag
tacatcaacgaagcgcacgacagcgggaagaagatcttggtcgagggcgcgaacgcgacg
atgctcgatttggacttcgggacgtacccgttcgtgacgtcgtccaacccggctctcggc
ggtgtttgcaacggtctcggtttggcgccgagaaagtttaaaaccatcatcggcgtcgcc
aaggcctacacgacgcgagtcggcgccggcccgtacccaaccgagctcttcggcgacgtc
gccgataagcttcgggagttgggttacgagtacggtaccaccacgggacgtccgagaaga
attggctggcttgacatggttgcgttgaactacgccaacctgatcaacggcttcacgcac
ttgaacatcaccaagctcgacgtcctgagcgaaatggacgagctcaagatcggcgtcgcg
tacaagcttcccaacggtaagaccacgaagtctttcccggccgacatcgcaacgttggaa
aaggtggaaacggtatacgaaaccctccccggctggaaggaggacatctccaaggttcgc
acctgggacgacctcccggagaacgccaaaaagtacgtcctccgcgtcgaagagctcgcc
ggtgttgaatgcaagttcatcggcgtcggaccgggtcgggacgccatggtgatcaagcct
tag

DBGET integrated database retrieval system