KEGG   Ostreococcus tauri: OT_ostta08g03490Help
Entry
OT_ostta08g03490  CDS       T01358                                 

Definition
(RefSeq) P-loop containing nucleoside triphosphate hydrolase
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
ota  Ostreococcus tauri
Brite
KEGG Orthology (KO) [BR:ota00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OT_ostta08g03490
Enzymes [BR:ota01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     OT_ostta08g03490
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     OT_ostta08g03490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase Dscam_C
Motif
Other DBs
NCBI-GeneID: 9831489
NCBI-ProteinID: XP_003080910
Position
8
AA seq 567 aa AA seqDB search
MDILRRRPVAATPRTDARSRRRTTMRRAQSSQSKKMIPMKPPASSRSNDLGSTSSDDTDA
SNIVRNASATHERMMRERMRIRENLARTRVSRFARAPGGGLLDRVTGLQMRESESEAKRM
ESFAARQIDQERASKVRAAEARAGALRDSLRRAEAELAELRRATANGDVVRRPAMQASDP
QAVREAGAKRVGTASLGKAARKLARSRSLSKKKSIDVSMRDEKDKTRRAPAREVVSKYQR
DTTPQAVSVREEVCLLPKPIFVVSDSTGATAAKAVQAALGQFEQCMHMPYPTNLEMFRFI
NDKSELAAIVQQAKEDDALIVYTLAEVDMSLAMASLAGDAGVRFVNVWENLLKQMEEHME
IPLMNLPMIKRPSGEAETRQSAEALLSSDYYRMIEAVEYTRQCDDGASSHRWREADILIL
GISRTGKTPLSIFLGQRGYKVANYPLVPIDGKLVLPPHIADVDPRRVFCLMISADVLHSI
RAHRLQTMGVADAEREFRNSRHAARRSVYSDLGVVRRELELARALYASNDAYKILDVTHK
GVEETAARIMAVMSDRFGRAHRRADAE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggatattttacgccgacgccccgtcgcggcgacgccgcgaacggacgcgcgttcgcga
cgccgaacgacgatgcgtcgcgcgcaaagctcccaatcaaaaaagatgattccaatgaaa
ccgcccgcgtcgtcgcggtcgaacgacctcggatcgacgtcgagcgacgacacggacgca
tcgaacatcgtgcgcaacgcgtcggcgacgcacgagcggatgatgcgagagcggatgcgg
attcgtgaaaatttggccaggacgcgggtgagtcggttcgcccgcgcgccgggcggcggg
ttgttggatcgcgtcaccggtctacagatgcgcgagagcgaatcggaggcgaagcggatg
gaatcattcgcggcgagacagatcgatcaggagcgggcgtcgaaggttcgggcggcggag
gccagggcgggggcgctgcgggactcgttgcggcgcgccgaggcggagctcgccgagctg
cgaagagcgaccgcgaacggggacgtggttcgaagaccggcgatgcaagcgagtgatcct
caggctgtgcgtgaggctggggcgaagcgcgtgggcacggcgtcgctcgggaaggctgcg
aggaagttggcgcgctcgcggtcgctctcgaagaagaagtcgatcgacgtctcgatgcgg
gacgagaaggacaaaacgcgcagggcgcccgcgcgcgaggtggtgagtaagtaccagcga
gacacgacgccgcaggcggtgagcgtgcgcgaggaggtgtgcctgctcccgaagcccatc
ttcgtggtttcagattccacgggcgcgacggctgcgaaagccgtgcaggcggcgcttgga
caattcgagcagtgcatgcacatgccttaccccacgaatttggaaatgttccgattcatt
aatgataaatccgagctggcggcgatcgtgcagcaggccaaggaggacgacgcgctcatc
gtgtacaccctggccgaggtcgacatgtcgctcgcgatggcctcgctcgcgggcgacgcc
ggagtgcgcttcgtgaacgtctgggaaaatctcttgaagcagatggaggagcacatggag
ataccattgatgaacttaccgatgatcaaacgcccgtccggcgaagcggagacgcgacag
tccgcggaggcgctgctctcgagcgattactatcgcatgattgaagccgtggagtacacc
cgacagtgcgacgacggcgcgtcgtcgcacaggtggcgggaggccgacattctcatcctg
ggcatctctcgcaccggtaaaaccccgttgagcattttcttgggccaacgcgggtacaag
gtggcgaattaccccctggttcccatcgacggaaagctcgtcctcccgccgcacatcgcg
gacgttgaccctcgtcgcgtcttctgcctcatgatctccgccgacgtcttgcactccatc
cgagcccatcgattacaaaccatgggtgtcgccgacgccgagcgcgagtttcgaaactcc
cgccacgccgctcgccgttccgtctactcggacctcggcgtcgtccgccgcgagctcgag
ctcgcccgcgccctctacgcctcgaacgacgcgtacaaaatcctcgacgtcacccacaag
ggcgtcgaagaaaccgccgcgcgaatcatggccgtgatgtccgaccgtttcggccgcgcc
catcgtcgggcggacgccgagtag

DBGET integrated database retrieval system