KEGG   Ostreococcus tauri: OT_ostta12g01870Help
Entry
OT_ostta12g01870  CDS       T01358                                 

Definition
(RefSeq) ApaG domain
  KO
K06195  ApaG protein
Organism
ota  Ostreococcus tauri
Brite
KEGG Orthology (KO) [BR:ota00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    OT_ostta12g01870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 DUF4248 DUF5643
Motif
Other DBs
NCBI-GeneID: 34946300
NCBI-ProteinID: XP_022840100
Position
12
AA seq 260 aa AA seqDB search
MSARSLARATFRGFLRASRVLDEQLSRTQASQASEVFTEREHEELTEILPRVFERLKGRT
VADVAREEYRAASASEEHLSDRLDAALRALRTLRMRLERMRVMAPSPCSDATTRGVRVRV
KASLVPAQTAPVMERYVYAYEVEIENENEEAVQVVSRRWRVVDEDGNAEEIEGSGVVGEQ
PTLAKGEKFSYTSATVLKRIRGSMSGTYVCVSQETKEVFEAEIAPFALTPPRFTKEDAAA
DSEDDEDDDIAALTRESAPL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgcgctcgctcgctcgcgccacctttcgcgggtttctccgagcctcccgcgtc
ctggacgaacagctctcgcgaacccaagcgagccaagcgagcgaggttttcaccgagcga
gaacacgaggagctcacggaaatcttacctcgagttttcgagcgtttaaaggggcgaacg
gtcgccgatgtcgctcgagaggagtaccgggcggcgtcggcgagcgaagagcatctgagc
gatcgtttggatgccgctttacgggctttacggacgctgaggatgcgattggaacggatg
cgggtcatggcgccgagtccgtgtagcgacgcgacgacgcgaggggtcagagtaagggtc
aaagcgtccttggtcccggcgcagacggcgccggtgatggagagatacgtgtacgcgtac
gaggtggagatcgagaacgagaacgaggaggcggtacaggtggtttcgcggaggtggaga
gtcgtggacgaggatgggaacgcggaggagatcgaggggagtggcgtcgtcggcgaacaa
ccgacgctcgcgaagggtgagaaattttcgtacacatctgcgactgtcctgaaacgcatc
cgcggatcgatgagcggaacatacgtgtgcgtctcgcaggagacgaaggaagttttcgaa
gctgagatcgccccgttcgcgctcacgccgccgcgtttcaccaaagaggacgccgccgcg
gattctgaggacgacgaggacgacgacattgcggcgcttacgcgcgaatctgccccgctc
taa

DBGET integrated database retrieval system