KEGG   Ostreococcus tauri: OT_ostta16g00250Help
Entry
OT_ostta16g00250  CDS       T01358                                 

Definition
(RefSeq) Helicase, C-terminal
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ota  Ostreococcus tauri
Pathway
ota03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ota00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    OT_ostta16g00250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ota03041]
    OT_ostta16g00250
Enzymes [BR:ota01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     OT_ostta16g00250
Spliceosome [BR:ota03041]
 Complex C
  Other components
   Step II factors
    OT_ostta16g00250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_19 AAA_22 AAA_30 Flavi_DEAD DUF2075 ABC_tran SRP54 AAA_23 AAA_24 UvrD-helicase AAA_29
Motif
Other DBs
NCBI-GeneID: 9836532
NCBI-ProteinID: XP_022840282
Position
16
AA seq 695 aa AA seqDB search
MESDETWSLDLSDLPVSRRANEIACAVEKNAVTVIIGETGSGKTTQIPQILLKAGVIAED
KAVCVTQPRRVAAVSVAKRVAEEMRVRVGEEVGYGVRFEDRTSTATRIKYVTDGTLLREL
LEDPQLSKYSIVVLDEAHERSLNTDILFGVLKKLVTTRAEKFRLVITSATLDGEKFSRYF
GSPVFTIPGRTYPVQIAHSTHAPRSYFESAIETVMDIHLNAGPGDVLCFLTGRDEIEKCC
RRIEDAVRTTRQCMDMQVLPLYASLTPDMQSRVFQPHDANVRRVIVATNIAETSLTVPGI
VFVIDPGVVKQIEYDAATGMESLQVVQISKVQAQQRAGRAGRTQAGRCYRLYTKDALEHD
MPKVTRPEIQRTCLVATILYLKTLDLKDLDVMTFDFLDAPDPDLIADALRQLYLLGGIDD
DGNPTRVGREMSTLPLEPSLARAMVEARHFGCVLETATVAAMLSVGQHYDEATSLLELVS
HDDFLMGDHIVLLRVFQAWERDGYRRSFLKRFSLSERGMEFARDIRKQLLGLVEVTRTSH
DQGLRMLRRSLCVGFATKIAHRLPHHNGYRTLGEHSTLCQVYPTMARQLADDDGLLPEWI
LFHEFVLTSRPYLRYVCKIESEWISKQREMLSKKIDIHRLSRGALNPSLSSQLNTKPTAT
EVDVGLKAPGARKTTEEDISAARERYLARKRKALD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgatgagacttggagcctcgatttgagcgatctcccggtgtccagacgagcg
aacgagatcgcgtgtgcggtggagaagaatgccgtgacggtgattataggggagacgggg
agcgggaagacgacgcagataccgcaaatactgttgaaagcgggtgtcatcgccgaagac
aaggctgtgtgcgtgacgcagccgagacgagtggccgctgtgagcgtcgccaaacgcgtg
gcggaggagatgcgcgtaagggttggagaagaggttggctacggcgtgcgttttgaagat
aggacgtccacggcaacgaggatcaagtatgttaccgatggcactctgttgcgcgagctt
ctcgaggatccgcaactgtctaagtactcaattgtcgtccttgatgaagcgcacgagcgt
tcgttgaacacagacatcttatttggagtattaaaaaaactcgtgaccactcgtgcagag
aagttcaggctggtgatcacgagcgctactctcgatggtgaaaagttttcacgttacttt
ggttctccggtatttactatacctggacggacatatccggtgcaaatcgcgcatagtacc
cacgcgccgcgttcatactttgagagtgcgatcgagacggtgatggatattcacttgaac
gccggtccgggtgatgtgctgtgcttcttgacagggcgagatgaaattgagaagtgctgt
cgccgtatcgaagatgcagtgcgaacaacgaggcagtgtatggacatgcaagttttacct
ttgtacgcgtcgcttactccggatatgcagtcgagagtgtttcaaccgcacgacgcgaac
gttcgacgagtcattgtggcgacaaacattgctgaaacgtcgttgactgtacctggaatt
gtttttgtgatcgatccaggcgttgtgaaacagatcgagtatgacgcagcaaccggtatg
gaatctttgcaagtcgttcaaattagcaaagtacaggcccagcagcgagctgggcgtgcc
gggcgtactcaggctgggagatgctaccgactctacacgaaggacgcgctcgagcacgac
atgcccaaagtgactcgtccagagatacagcgaacgtgtcttgtcgcgaccattctgtat
ttgaaaacattggacctgaaagatttggatgtcatgacgttcgactttttggacgctccc
gacccggacctcatcgcggatgcgctcaggcagctgtacctccttggcggtatcgacgac
gatggaaatccaacccgtgtcgggcgcgagatgagcacgctaccgctagaaccaagtttg
gcgcgtgccatggttgaagctcggcatttcggttgcgttctcgagaccgcgacggtcgcg
gcgatgttaagcgtgggtcagcactacgacgaggcgacaagtctactcgaactcgtatcg
catgatgactttctgatgggtgatcacatcgtgcttcttcgtgtatttcaagcatgggag
cgagacgggtatcgacgaagctttctgaaaagattctcgttatctgagagaggtatggag
tttgcccgtgacatacgtaagcagcttctcggacttgtcgaggtgacacgaacttcacac
gatcaaggtttgagaatgttgcggcgatcactttgcgtgggattcgcgacaaaaatagcg
catagactgcctcatcataacgggtatcggacactaggggagcattcgacgctgtgccaa
gtgtatcccaccatggcccgtcagcttgccgatgatgatggcttgcttccagagtggatc
ctcttccacgagttcgttctgacgtctcgtccctacttgagatatgtgtgcaagatcgag
tctgaatggatttcgaagcagcgagagatgttgtctaagaagatcgacattcaccgactc
agcagaggcgcactcaacccatctctgtcaagtcagctcaacacgaaaccgacagcgaca
gaggtagacgtcggcttgaaagcgcctggggcgcgcaaaaccacggaagaggacatttct
gcggcgcgcgagcgctatctcgcacgtaagaggaaagcattagattga

DBGET integrated database retrieval system