KEGG   Ostreococcus tauri: OT_ostta17g02170Help
Entry
OT_ostta17g02170  CDS       T01358                                 

Definition
(RefSeq) Mandelate racemase/muconate lactonizing enzyme,C-terminal
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
ota  Ostreococcus tauri
Pathway
ota00130  Ubiquinone and other terpenoid-quinone biosynthesis
ota01100  Metabolic pathways
ota01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ota00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    OT_ostta17g02170
Enzymes [BR:ota01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     OT_ostta17g02170
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     OT_ostta17g02170
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     OT_ostta17g02170
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     OT_ostta17g02170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chorismate_bind TPP_enzyme_N MR_MLE_C Abhydrolase_6 TPP_enzyme_M_2 Abhydrolase_1 TPP_enzyme_M Hydrolase_4 Thioesterase MR_MLE_N Lipase
Motif
Other DBs
NCBI-GeneID: 9838136
NCBI-ProteinID: XP_022840497
Position
17
AA seq 2067 aa AA seqDB search
MRVAFRPDLAHGAIASSNAHRTRAKRHRGRTPRSVSDESVADRTPSQRESTSRNVVTSNE
DDAQAVNRASNAVEPAECRVTRDLGRAVSAKEGWRRLARATRESRRDVERSGESRNESGC
VRFVIDVPRGDACLDWVREASGRAGEGAPAFYWSPRARTASGGGKASGRTRDGSVEDDGR
ASRHDGMLSSDRGARAGLGACATWTDAGEEDESSFQRRIASMRRFLSGHQSGRAGARVYG
AGRFDPGRTPEAEWASFGTHFFFLPVLEVVEGVKCATLSVCVAWDAKGDENCGPSAKSFV
QALDDACEMLKRSMSVNLSSNETLPPGAAHVTDRTLVPDENGWSKDVSSVIDRIRASKAS
SSSNREKGEAWVDLGSSFDEADSPNVRSALESLGRAVGLEAPSAVLDQFEAMTMARSLSD
ENVNSDGMVDAMLLGGKSMEPLRKVVLARRSKLALSAPVNTFDLISRLQARDPDAYQFVL
RHPNGETFLGSTPERLFLSQGGRASSEAVAGTRARGSDDGEDAALAYDMLLSPKEHEEFA
IVREEVRRALGEVAEGGNDGIDVELEKGILRNVTVQHLYSRLSAPLAGGKNEADLICALH
PTPAVCGYPRPAALRTLRAVESFDRGLYSGPLGWIGAEDAEFAVAIRSALVHPSGDEVSL
YAGVGVVGSANAQAEWSELNLKTKPLESLLAPAPRLASLPNPNAAWATILVGELVRGGIT
TFCVAPGSRSTPLALAAEKHVGANVVVCIDERSLGFYALGYAKGSGQPAAVICSSGTAVA
NLLPSVVEASESSTPLLLLTADRPYELRNTGANQTIDQVKIFGSYTRFNADLAPPGDGSP
ARACATMASTALRHLRGVDSGPVHLNCAFREPLGPQRVEWDSVTALKGLENWEASSTQFT
IGNASISAPQDGSAWQSALSRISRAKRGLFVVGGGTTAADAIAATAMAETLGWAVAADAT
SGMRVGACENASVRMIPMIDYVLVEPSTHEVLRPDVIVQVGTRLTSKRLNQFLETSAIDH
GAEWIIIEPTPNRHDPAHCVSVRVESSIGHASELLERALNDESGYAMSERKAACVAFADR
AVSIGEAVAREAAVALDDITINEGVSEMAVAVAISEGLPDSMGLFLGNSMPIRDIDTFAG
IKRYAEGFEKSDGTSLGVPVSANRGASGIDGVISTAAGYAAGLGHPVTLIIGDVSFQHDS
NGLLFLRERPGQPPVTVVVVNNGGGGIFSFLPVAAQVDDSSFNRLFATPPDVSRRGLCEA
HRVTYSHPRTIEELRRALRTSWTENQHNVIEVTTSRARNLVQHKMVQRRCAHAARRALRL
SAESTAKIVRGVEIASFSIPLNKPTTTVSASMQREGMILKVTLSDGSVGFGECSPLPGLH
RETLQESRAQLAVVASLLDNIDVPTNISLLNGAFTSWLESRVGIRTPNGELFPSVRFAVE
AAVANALAASVGEPLAHIMTGNADTSGVFVNGLVDAATDIDAARREARDLVDAGFTCLKV
KVARGVGKEGANADAERLAAIRAEIGPSVVLRADANKGWDLNDALHFGARVVDLGVNLQY
VEEPTRDARDIATFHFTTSIPVALDETIDEIVRSSANFTDASATVAQIADQSTGVAAIVL
KPSVVGGLEATTTLARAAMSRGVRPVISSAFESNIGLNTCAHLAGFLEDALEREICAAKD
TSTQNDNTERSGASESPKPLILELDNQPSAHGLGTATWFNGDVMSPNSAPVVKRSNGVTI
EFTAVDAALSKATEFMSDFTNSTRAWGEPTTVRVETPNGCFGVHVVDSQRSDVKQTIVLL
HGFMGSSTDWDVVARGLAASGDARVVAIDLPAHGETTISPNPNKSMSDCLSIEEMRDVVA
MVLSQIGCAPESTHVVGYSMGARVALALDEHLVKTIVSIGGSPGVRGDEARRARAARDDA
LASALRKGAGVREFAEVWYKQSLFTSLIEHPRLGGVEGLSARRGSTRGADAEILATCLSA
ASPGRQGEQWSGLGRFAGKLTLIVGEKDEKFKAMSFKMRDAVAETSALAEDAVSVLIVPD
SGHAVHLEAPEAVVRRVLRAIRREKYR
NT seq 6204 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgcgtttcgcccagacctcgcacacggggcgatcgcgtcatcgaacgcgcat
cgaacgcgcgcaaagcgtcatcgcgggcgcacaccgcgctcggtgagcgacgagagcgtc
gcggataggactccgtcgcagcgcgaatcaacctctcgaaacgtcgtcacctcgaacgag
gacgacgcgcaggcggtaaaccgcgcgtcgaacgcggtcgagcccgcggagtgccgggtg
acgcgcgatttaggtcgggcggtgagcgcgaaggagggttggcggcgcctcgcgcgggcg
acgcgcgagtccagacgcgacgtcgagcggagcggtgagtcgaggaacgagagcgggtgc
gtgcggttcgtgatcgacgttccgagaggggatgcgtgtttagattgggtgcgagaggcg
agcggacgcgctggagagggtgcgccggcgttttattggtcgcccagggcgcgcacggcg
agcggcggcggaaaagcgagcggaaggacacgcgatggatcggtcgaggacgacggacgc
gcgagcaggcatgacgggatgttgagttctgatagaggcgcgcgcgcgggtttaggggcg
tgcgcgacgtggacggacgcgggagaggaggacgagtcttcgtttcagcggcgcatagca
tccatgcggaggtttcttagcggtcatcagagcggacgtgccggcgcacgcgtgtacgga
gcgggacgattcgaccccggacgcacacctgaggcagagtgggcgtcgttcgggacgcac
ttcttcttcttacccgtgctcgaggtggtggagggcgtcaagtgcgccacgctctcggtg
tgcgtcgcgtgggacgcgaagggcgacgagaactgcggtccctcggcgaagtcgttcgtt
caagcgttggatgacgcgtgtgagatgctcaagcgctcgatgagcgtgaacctgagctcg
aacgagacacttccgcccggagcggcgcacgtaacagacaggactctggtgcctgatgag
aacgggtggtccaaggacgtgtcctccgtcatcgatcgtattcgagcatccaaggcgagt
tcgagctcgaatcgcgaaaagggtgaggcgtgggtggacttgggaagtagctttgatgaa
gcggattcaccaaacgtgcggtccgcattggagtcgctcgggcgcgcggtgggcttagaa
gcgccaagcgcggttctcgaccagttcgaggcgatgacgatggcgagaagtctctcggat
gaaaacgtgaattcagacggcatggtggacgccatgcttctcggaggaaaatccatggaa
ccgctgcgtaaagtcgtcttggctcgccgtagcaagctcgcgctcagcgcgccggtgaac
acatttgacttgatttctaggcttcaagcccgcgaccccgacgcgtatcagttcgttttg
aggcatccaaacggagagacgttcttaggatcgacccctgaacgtttgtttctgagtcaa
ggaggaagagcttccagcgaagccgtggcaggcacgcgcgcgcgaggctctgacgacggt
gaagacgcagcgctcgcttacgacatgcttttgtcgccaaaagaacacgaagagttcgcg
atcgtaagagaagaagttcgtcgtgctctcggggaagtcgcggagggtggaaacgatggc
atcgacgttgagctggagaaaggcatcctacgaaacgtcacggttcagcacttgtactca
cgcttatccgcacctctggctggagggaagaatgaggccgatttgatctgcgcgttgcat
ccaacgcccgccgtgtgcggttatccgcgtcccgcggcgcttcgcactcttcgagcggtg
gaatccttcgacagaggcttgtactcgggacccttgggctggatcggcgcggaagacgcg
gaatttgccgtagcgattcgctccgcactggtgcatccgagcggcgacgaggtatcgctg
tatgcaggtgtcggtgtcgttggctccgctaacgctcaagccgaatggtccgagctgaat
ttgaagacgaaaccactggaatcgttactggcgccggcgccgcggctcgcgagtctaccc
aacccgaacgccgcgtgggcgaccattctcgtcggtgagcttgtacgaggaggtattacg
accttttgcgttgcaccggggagtcgttcgactcctcttgcgctcgcggcggagaagcac
gttggcgcgaatgtggttgtttgtatcgacgaacgatcgctaggcttttacgcgctcgga
tacgcaaagggttccggacagcctgcggcggtgatttgtagcagcggtaccgccgtggcg
aaccttttaccatcggtggtggaagcatccgagagttcgacgcccttgctgttgctcacc
gccgatcgtccgtacgagctgcgtaacaccggtgcgaaccaaacaatcgatcaggtgaaa
atattcggatcttacactcgattcaatgcggatttggcgccgccgggtgacggttcgccc
gcgcgtgcgtgcgcaacaatggcatccaccgcactgaggcatctgaggggcgttgattcc
gggccagtgcacctgaattgcgcgttccgcgagcctttggggccgcagcgcgtggagtgg
gactccgtgacggcgctcaaaggattggagaactgggaggcgtcttcaacgcaattcacg
atcggcaacgcctcgatcagcgcccctcaggatggaagtgcgtggcaatcagccttgtcg
cgcatctctcgggcaaagcgaggtttattcgtcgtcggaggcggcacgacagccgcagat
gccattgccgccacagcgatggcggagacgttgggatgggccgtcgctgccgacgccacg
agcggaatgcgcgttggcgcgtgtgagaacgcatcggtgcgaatgattccgatgattgac
tacgttctcgtggagccgagtacgcacgaagtgcttcgacccgatgtcatcgtgcaagtt
ggcactcgcttgacgtccaaacggttgaatcagttcctcgagacgagcgcgatcgaccac
ggtgccgaatggatcatcatagagccaacgccgaaccgacatgacccagcgcactgcgtc
tctgtcagagtcgaatcgtctattggtcacgcgtcggaactcttggagcgtgctctgaac
gacgagagcggatacgcgatgagcgagcgcaaggcggcatgcgtcgccttcgctgatcga
gccgtctccatcggtgaggcagtcgctcgcgaagctgccgtcgcactcgatgatataaca
atcaatgaaggagtctccgagatggcggtcgctgtcgcgatcagcgagggcttgccggac
tctatgggtttgttcctcggaaattcgatgcccattcgcgacattgacacatttgcgggt
atcaaacgatacgctgaaggcttcgaaaagtcggatggcacctcccttggagttcctgtg
agcgcaaacagaggtgctagcgggatcgacggcgtcatatcgaccgccgccggttacgcc
gccggtctcggacatccagtcacgctgatcatcggagacgtgtccttccaacacgattcc
aacggtttgctgttccttcgcgaacgaccggggcaaccacctgtgacggtcgttgtcgtc
aataacggtggcggtggcatattctcattcttaccagtcgccgcacaagtcgatgattct
tcgttcaatcgcttgttcgcgacgccaccggacgtttcgagacggggtctgtgcgaggcc
catcgcgtgacgtactcgcatcccagaactatcgaagagcttcgaagagctctccgtaca
tcgtggaccgagaatcagcacaatgttatcgaagtgacgacatcacgagcgagaaacttg
gtccagcacaagatggttcagcgtcgatgcgctcatgccgcgcgacgtgcgctgagactc
tccgccgagtcgacggcaaaaatcgtacgaggagtggagattgcttccttttccattcct
ctgaacaagccaacgacgacggtaagtgcttcaatgcaacgcgaaggcatgatactgaag
gttactctgagtgatggaagcgttggcttcggcgaatgctcacctctacccggactccat
cgcgagactcttcaagagagcagagcgcagcttgcggttgttgcttctcttctcgacaac
atcgacgtgcctacgaacatcagtctgctgaatggtgcgttcacgtcgtggttggagagt
cgtgtcggtattcgaacgccgaacggcgagttattcccttccgtacgattcgccgtcgaa
gccgccgtcgcgaatgcgctggccgcgagcgtgggcgagcctctcgcgcacatcatgact
ggtaatgccgacaccagtggtgttttcgtcaacgggctcgttgacgccgctacggatata
gatgctgcgcgaagagaggcacgagatctcgtggacgctggattcacgtgcttgaaagtc
aaggtggctcgaggagttgggaaagagggcgcgaacgccgatgccgagcgcctcgcagcg
attcgagcggaaatcggaccgagcgtggtcttgcgcgcagacgccaacaaaggatgggat
ctgaatgatgcgctccactttggcgcacgcgtcgttgatctcggcgtcaacttgcagtac
gttgaagagcccactcgcgacgcgagagacatcgctacgtttcacttcaccacgagcatc
cccgtggcgttagatgagactatcgatgaaatcgtgcgttcatctgcgaactttaccgac
gcgagcgcgaccgtggctcaaatcgcagaccaatcgaccggagtcgccgccattgttctg
aagccgtctgtcgtcggtggcctcgaggcgactacaactctggcgagagctgccatgtcg
cgaggagtgcgtcctgttatctcgagtgctttcgagagtaatattggcttaaatacgtgc
gctcatctcgccggtttccttgaagacgcacttgagcgcgaaatttgcgccgcgaaagat
acgtcaacacaaaacgacaatacggagcgctccggcgcatcggaatcccccaagccactc
attctcgagttggacaatcaaccgagcgcgcatggcttgggaaccgcgacgtggttcaac
ggcgatgtcatgtctccaaactcagcgccagtagtgaaacgatcgaatggtgtcacgatt
gagttcaccgcagtggacgctgcgttgtcgaaagcgacggagttcatgtcggactttact
aactcgacgcgcgcttggggcgaacccacgacggttcgcgtggagaccccgaatggttgt
ttcggcgttcatgtcgtcgatagtcaacgcagtgacgtgaaacaaaccatcgtgcttttg
catggtttcatgggttcgagcactgattgggacgtcgttgcccgaggtcttgcggcgtcg
ggcgacgctcgcgttgtcgccattgatttacccgctcacggagagacaacaatatctccg
aaccccaataaatccatgagcgattgcctgagcatcgaagaaatgcgtgacgttgtggcg
atggtgctgtctcaaattggatgtgcgccggaatcgacgcacgtcgtcgggtacagcatg
ggtgctcgtgtcgcgctcgctctggacgagcatctagtgaagacgatcgtttccataggt
ggatcgccgggcgtccgtggcgacgaagcgcgacgcgcgcgcgctgctcgagatgacgca
ctggcgagcgctcttcgcaagggtgcgggcgtgcgcgaattcgcagaggtttggtacaaa
cagagtttgtttacttcgctcatcgagcaccctcgactcggcggcgtcgaaggtctctcc
gcacgtcgaggatcgactcgcggtgcagatgcggagatacttgcgacgtgcctctcagcc
gcgtcgcccggtcgtcaaggcgaacagtggtcaggtctcggacggttcgcgggcaaactc
accctcatagtcggcgaaaaggatgagaaattcaaggcgatgtccttcaagatgcgagac
gccgtggcagagacctccgcgctcgcggaagacgcagtgagcgtgcttatcgttccggat
agcggacacgccgtgcacttagaggcgccagaagcggtcgttcgtcgcgtgcttcgcgcg
attcggcgcgaaaaatataggtag

DBGET integrated database retrieval system