KEGG   Opitutus terrae: Oter_0564Help
Entry
Oter_0564         CDS       T00689                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ote  Opitutus terrae
Pathway
ote00010  Glycolysis / Gluconeogenesis
ote00260  Glycine, serine and threonine metabolism
ote00680  Methane metabolism
ote01100  Metabolic pathways
ote01110  Biosynthesis of secondary metabolites
ote01120  Microbial metabolism in diverse environments
ote01130  Biosynthesis of antibiotics
ote01200  Carbon metabolism
ote01230  Biosynthesis of amino acids
Module
ote_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ote00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Oter_0564
  Energy metabolism
   00680 Methane metabolism
    Oter_0564
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Oter_0564
Enzymes [BR:ote01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Oter_0564
Membrane trafficking [BR:ote04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Oter_0564
Exosome [BR:ote04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Oter_0564
  Exosomal proteins of melanoma cells
   Oter_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACB73854
UniProt: B1ZSJ7
Position
682137..682754
Genome map
AA seq 205 aa AA seqDB search
MTTTLYLVRHAQSLPLMHQPEPDWALSPAGEAQATGLVPALAPLGITRIYTSPYRRCRDT
LVPFADACGLEIAVHEGLRERRIAGQWVPDFREVWRRSWEDFSFALDGGECSWTCRARIA
AAVDELVHRHPGETLALGSHGNALALFLHFVEPAFGVHDASAIRTPEILKVTHSDGRYHW
RRDFHAGAGFEVLATDFRLTPGIVA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgacgctgtatctcgtgcggcatgcgcagagcttgcccttgatgcatcagccg
gaaccggattgggcgctctcgcccgccggcgaagctcaggcgaccggactggtgccagcg
ctcgcgccgctcggaatcacgcggatctacaccagcccctaccgccgctgtcgcgacacg
ctcgtcccgttcgcagatgcctgcggcctcgagatcgccgtgcacgaaggcctgcgcgaa
cgtcgcatcgccgggcagtgggtgccggactttcgcgaggtgtggcgacgctcgtgggag
gatttctcgttcgcgctcgacggcggcgagtgctcgtggacctgccgtgcgcggatcgcc
gccgcggtggacgaactcgtgcaccgtcatccgggcgagacgctggcgctcggctcgcat
ggcaatgccctcgcgctcttcctgcacttcgtcgagcccgcgttcggcgtgcacgacgcg
agcgccattcgcacacccgagatcctgaaagtgactcattcggatggccgctatcactgg
cgccgtgacttccatgcaggcgccggcttcgaggtgctcgccaccgatttccggctcacg
ccgggcatcgtcgcgtag

DBGET integrated database retrieval system